F153481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 132 | 29 | 264 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0016009|Ga0316584_0016009_998_2380 |
| Length | 460 |
| Sequence | MTLRKGRCAVIHRHNAVQMTREAPNINHEGKMGKTIAQKIFDSHHVDNPHDDIHVIRLDAVFCHEITTPVAILDLIRNGKDKVFDPDKIKVVIDHVSPAKDSKTAEQGKILRDWARRHHIRDFFDIGRNGVCHALFPEKGFVRPGYTVIMGDSHTCTHGAFGAFAAGVGTTDLEVGILKGVCALHYPQTLKIHIFGTLQKGVFAKDVILFIIGKLGVNGATGKVIEFTGPVVDAMDMAARMTLCNMAIEAGGTCGICYPDPMTVDYLWPFIENAYPSKADALDRFQQFVSDPDADYDQVIDIDVSNLAPLATYGFKPDQVKPVAELAGTAVDQVYIGSCTNGRIEDLRTAAGILKGNTIRDTVRAIVSPATPHIFQQALDEGLIKIFMDAGFCVTNPTCGACLGMSNGVLAPGEICASTTNRNFNGRMGKGGMVHLMSPATAAATAIAGHICNSPLYEGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 3 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 4 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 5 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 6 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 7 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 8 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 9 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 10 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 11 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 12 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 13 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 14 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 15 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 16 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 17 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 18 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 19 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 20 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 21 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 22 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 23 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 24 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 25 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 26 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 27 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 28 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 29 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 78.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0016009 | 3300036712 | Bacteria | 5372 |
| 2 | Ga0265318_10002202 | 3300028577 | Bacteria | 10533 |
| 3 | Ga0265316_10094614 | 3300031344 | Bacteria | 2276 |
| 4 | Ga0307509_10184554 | 3300031507 | Bacteria | 1946 |
| 5 | Ga0316575_10000057 | 3300031665 | Bacteria | 27133 |
| 6 | Ga0316575_10000144 | 3300031665 | Bacteria | 18022 |
| 7 | Ga0316575_10003634 | 3300031665 | Bacteria | 5350 |
| 8 | Ga0316575_10048121 | 3300031665 | Bacteria | 1695 |
| 9 | Ga0316579_10001062 | 3300031691 | Bacteria | 9718 |
| 10 | Ga0316576_10002748 | 3300031727 | Bacteria | 10091 |
| 11 | Ga0316576_10014811 | 3300031727 | Bacteria | 5214 |
| 12 | Ga0316576_10035302 | 3300031727 | Bacteria | 3569 |
| 13 | Ga0316576_10051091 | 3300031727 | Bacteria | 3008 |
| 14 | Ga0316576_10067172 | 3300031727 | Bacteria | 2639 |
| 15 | Ga0316576_10070378 | 3300031727 | Bacteria | 2580 |
| 16 | Ga0316576_10178668 | 3300031727 | Bacteria | 1601 |
| 17 | Ga0316578_10001535 | 3300031728 | Bacteria | 9486 |
| 18 | Ga0316578_10003944 | 3300031728 | Bacteria | 6909 |
| 19 | Ga0316578_10036477 | 3300031728 | Bacteria | 2829 |
| 20 | Ga0316578_10076468 | 3300031728 | Bacteria | 1988 |
| 21 | Ga0316577_10001335 | 3300031733 | Bacteria | 11565 |
| 22 | Ga0316577_10003070 | 3300031733 | Bacteria | 8380 |
| 23 | Ga0316577_10020236 | 3300031733 | Bacteria | 3689 |
| 24 | Ga0316577_10111784 | 3300031733 | Bacteria | 1533 |
| 25 | Ga0316583_10000128 | 3300032133 | Bacteria | 17702 |
| 26 | Ga0316583_10002057 | 3300032133 | Bacteria | 6900 |
| 27 | Ga0316583_10030530 | 3300032133 | Bacteria | 1918 |
| 28 | Ga0316585_10001735 | 3300032137 | Bacteria | 5804 |
| 29 | Ga0316580_10004889 | 3300032139 | Bacteria | 3895 |
| 30 | Ga0373928_0000152 | 3300035084 | Bacteria | 13269 |
| 31 | Ga0316574_0000252 | 3300035398 | Bacteria | 19516 |
| 32 | Ga0316574_0027123 | 3300035398 | Bacteria | 3449 |
| 33 | Ga0316574_0044689 | 3300035398 | Bacteria | 2741 |
| 34 | Ga0316574_0141737 | 3300035398 | Bacteria | 1549 |
| 35 | Ga0316582_0004961 | 3300036647 | Bacteria | 6798 |
| 36 | Ga0316582_0008208 | 3300036647 | Bacteria | 5599 |
| 37 | Ga0316582_0015749 | 3300036647 | Bacteria | 4333 |
| 38 | Ga0316582_0080571 | 3300036647 | Bacteria | 2125 |
| 39 | Ga0316584_0006676 | 3300036712 | Bacteria | 7826 |
| 40 | Ga0316584_0017918 | 3300036712 | Bacteria | 5101 |
| 41 | Ga0316584_0041497 | 3300036712 | Bacteria | 3430 |
| 42 | Ga0316584_0068957 | 3300036712 | Bacteria | 2651 |
| 43 | Ga0316584_0095754 | 3300036712 | Bacteria | 2222 |
| 44 | Ga0316584_0159384 | 3300036712 | Bacteria | 1677 |
| 45 | Ga0316581_0014573 | 3300037588 | Bacteria | 2240 |
| 46 | Ga0400484_19714 | 3300038725 | Bacteria | 11428 |
| 47 | Ga0400484_28773 | 3300038725 | Bacteria | 17886 |
| 48 | Ga0400490_06036 | 3300038726 | Bacteria | 1964 |
| 49 | Ga0400490_60022 | 3300038726 | Bacteria | 33981 |
| 50 | Ga0400485_02854 | 3300038735 | Bacteria | 9544 |
| 51 | Ga0400485_08956 | 3300038735 | Bacteria | 97119 |
| 52 | Ga0400485_14267 | 3300038735 | Bacteria | 34422 |
| 53 | Ga0400485_22137 | 3300038735 | Bacteria | 3905 |
| 54 | Ga0400488_10295 | 3300038741 | Bacteria | 1542 |
| 55 | Ga0400488_54453 | 3300038741 | Bacteria | 5784 |
| 56 | Ga0400486_04454 | 3300038742 | Bacteria | 77452 |
| 57 | Ga0400486_05265 | 3300038742 | Bacteria | 61476 |
| 58 | Ga0400486_12398 | 3300038742 | Bacteria | 2729 |
| 59 | Ga0400486_12740 | 3300038742 | Bacteria | 11177 |
| 60 | Ga0400486_28951 | 3300038742 | Bacteria | 11182 |
| 61 | Ga0400483_087347 | 3300039062 | Bacteria | 17357 |
| 62 | Ga0400483_126622 | 3300039062 | Bacteria | 6088 |
| 63 | Ga0400483_134954 | 3300039062 | Bacteria | 2989 |
| 64 | Ga0400483_207829 | 3300039062 | Bacteria | 67117 |
| 65 | Ga0400483_269129 | 3300039062 | Bacteria | 19498 |
| 66 | Ga0400489_16533 | 3300039093 | Bacteria | 17685 |
| 67 | Ga0400489_37886 | 3300039093 | Bacteria | 33445 |
| 68 | Ga0400489_54353 | 3300039093 | Bacteria | 32035 |
| 69 | Ga0400489_67717 | 3300039093 | Bacteria | 11639 |
| 70 | Ga0400489_81224 | 3300039093 | Bacteria | 33201 |
| 71 | Ga0400487_24802 | 3300039110 | Bacteria | 65057 |
| 72 | Ga0451577_0000050 | 3300042876 | Bacteria | 301123 |
| 73 | Ga0451577_0000398 | 3300042876 | Bacteria | 79644 |
| 74 | Ga0451577_0000465 | 3300042876 | Bacteria | 70232 |
| 75 | Ga0451577_0001583 | 3300042876 | Bacteria | 29702 |
| 76 | Ga0451577_0004892 | 3300042876 | Bacteria | 13965 |
| 77 | Ga0451577_0016220 | 3300042876 | Bacteria | 6903 |
| 78 | Ga0451577_0061208 | 3300042876 | Bacteria | 3357 |
| 79 | Ga0451577_0227537 | 3300042876 | Unclassified | 1686 |
| 80 | Ga0453683_0000002 | 3300044673 | Bacteria | 1244396 |
| 81 | Ga0453683_0000014 | 3300044673 | Bacteria | 364381 |
| 82 | Ga0453683_0000053 | 3300044673 | Bacteria | 197912 |
| 83 | Ga0453683_0000098 | 3300044673 | Bacteria | 132195 |
| 84 | Ga0453683_0000138 | 3300044673 | Bacteria | 105792 |
| 85 | Ga0453683_0000177 | 3300044673 | Bacteria | 88678 |
| 86 | Ga0453683_0000566 | 3300044673 | Bacteria | 40890 |
| 87 | Ga0453683_0000773 | 3300044673 | Bacteria | 31774 |
| 88 | Ga0453683_0000972 | 3300044673 | Bacteria | 27120 |
| 89 | Ga0453683_0002281 | 3300044673 | Bacteria | 15131 |
| 90 | Ga0453683_0005181 | 3300044673 | Bacteria | 9129 |
| 91 | Ga0453683_0008286 | 3300044673 | Bacteria | 6988 |
| 92 | Ga0453683_0019398 | 3300044673 | Bacteria | 4356 |
| 93 | Ga0453683_0028524 | 3300044673 | Bacteria | 3533 |
| 94 | Ga0453683_0035615 | 3300044673 | Bacteria | 3136 |
| 95 | Ga0453684_0000061 | 3300044712 | Bacteria | 489946 |
| 96 | Ga0453684_0000210 | 3300044712 | Bacteria | 255463 |
| 97 | Ga0453684_0000486 | 3300044712 | Bacteria | 156745 |
| 98 | Ga0453684_0000551 | 3300044712 | Bacteria | 141549 |
| 99 | Ga0453684_0000619 | 3300044712 | Bacteria | 129756 |
| 100 | Ga0453684_0001180 | 3300044712 | Bacteria | 80973 |
| 101 | Ga0453684_0001383 | 3300044712 | Bacteria | 70232 |
| 102 | Ga0453684_0001665 | 3300044712 | Bacteria | 60216 |
| 103 | Ga0453684_0004116 | 3300044712 | Bacteria | 31535 |
| 104 | Ga0453684_0004728 | 3300044712 | Bacteria | 28157 |
| 105 | Ga0453684_0006292 | 3300044712 | Bacteria | 22714 |
| 106 | Ga0453684_0008485 | 3300044712 | Bacteria | 18377 |
| 107 | Ga0453684_0009498 | 3300044712 | Bacteria | 17006 |
| 108 | Ga0453684_0023012 | 3300044712 | Bacteria | 9211 |
| 109 | Ga0453684_0024878 | 3300044712 | Bacteria | 8719 |
| 110 | Ga0453684_0035529 | 3300044712 | Bacteria | 6885 |
| 111 | Ga0453684_0041237 | 3300044712 | Bacteria | 6249 |
| 112 | Ga0453684_0051247 | 3300044712 | Bacteria | 5415 |
| 113 | Ga0453684_0055332 | 3300044712 | Bacteria | 5159 |
| 114 | Ga0453684_0058281 | 3300044712 | Bacteria | 4989 |
| 115 | Ga0453684_0074726 | 3300044712 | Bacteria | 4265 |
| 116 | Ga0453684_0078777 | 3300044712 | Bacteria | 4122 |
| 117 | Ga0453684_0087771 | 3300044712 | Bacteria | 3853 |
| 118 | Ga0453684_0144027 | 3300044712 | Bacteria | 2841 |
| 119 | Ga0453684_0224240 | 3300044712 | Bacteria | 2175 |
| 120 | Ga0453684_0299942 | 3300044712 | Bacteria | 1826 |
| 121 | Ga0453684_0428476 | 3300044712 | Bacteria | 1476 |
| 122 | Ga0451576_0000001 | 3300045051 | Bacteria | 1802108 |
| 123 | Ga0451576_0000257 | 3300045051 | Bacteria | 129821 |
| 124 | Ga0451576_0000566 | 3300045051 | Bacteria | 78998 |
| 125 | Ga0451576_0000573 | 3300045051 | Bacteria | 78637 |
| 126 | Ga0451576_0000956 | 3300045051 | Bacteria | 54199 |
| 127 | Ga0451576_0001317 | 3300045051 | Bacteria | 42974 |
| 128 | Ga0451576_0001815 | 3300045051 | Bacteria | 34787 |
| 129 | Ga0451576_0058315 | 3300045051 | Bacteria | 4035 |
| 130 | Ga0451576_0188527 | 3300045051 | Bacteria | 2154 |
| 131 | Ga0451576_0333117 | 3300045051 | Bacteria | 1588 |
| 132 | 2740991634 | 2740891818 | Bacteria | 6711283 |
| 133 | Ga0316584_0016009 | |||
| 134 | Ga0265318_10002202 | |||
| 135 | Ga0265316_10094614 | |||
| 136 | Ga0307509_10184554 | |||
| 137 | Ga0316575_10000057 | |||
| 138 | Ga0316575_10000144 | |||
| 139 | Ga0316575_10003634 | |||
| 140 | Ga0316575_10048121 | |||
| 141 | Ga0316579_10001062 | |||
| 142 | Ga0316576_10002748 | |||
| 143 | Ga0316576_10014811 | |||
| 144 | Ga0316576_10035302 | |||
| 145 | Ga0316576_10051091 | |||
| 146 | Ga0316576_10067172 | |||
| 147 | Ga0316576_10070378 | |||
| 148 | Ga0316576_10178668 | |||
| 149 | Ga0316578_10001535 | |||
| 150 | Ga0316578_10003944 | |||
| 151 | Ga0316578_10036477 | |||
| 152 | Ga0316578_10076468 | |||
| 153 | Ga0316577_10001335 | |||
| 154 | Ga0316577_10003070 | |||
| 155 | Ga0316577_10020236 | |||
| 156 | Ga0316577_10111784 | |||
| 157 | Ga0316583_10000128 | |||
| 158 | Ga0316583_10002057 | |||
| 159 | Ga0316583_10030530 | |||
| 160 | Ga0316585_10001735 | |||
| 161 | Ga0316580_10004889 | |||
| 162 | Ga0373928_0000152 | |||
| 163 | Ga0316574_0000252 | |||
| 164 | Ga0316574_0027123 | |||
| 165 | Ga0316574_0044689 | |||
| 166 | Ga0316574_0141737 | |||
| 167 | Ga0316582_0004961 | |||
| 168 | Ga0316582_0008208 | |||
| 169 | Ga0316582_0015749 | |||
| 170 | Ga0316582_0080571 | |||
| 171 | Ga0316584_0006676 | |||
| 172 | Ga0316584_0017918 | |||
| 173 | Ga0316584_0041497 | |||
| 174 | Ga0316584_0068957 | |||
| 175 | Ga0316584_0095754 | |||
| 176 | Ga0316584_0159384 | |||
| 177 | Ga0316581_0014573 | |||
| 178 | Ga0400484_19714 | |||
| 179 | Ga0400484_28773 | |||
| 180 | Ga0400490_06036 | |||
| 181 | Ga0400490_60022 | |||
| 182 | Ga0400485_02854 | |||
| 183 | Ga0400485_08956 | |||
| 184 | Ga0400485_14267 | |||
| 185 | Ga0400485_22137 | |||
| 186 | Ga0400488_10295 | |||
| 187 | Ga0400488_54453 | |||
| 188 | Ga0400486_04454 | |||
| 189 | Ga0400486_05265 | |||
| 190 | Ga0400486_12398 | |||
| 191 | Ga0400486_12740 | |||
| 192 | Ga0400486_28951 | |||
| 193 | Ga0400483_087347 | |||
| 194 | Ga0400483_126622 | |||
| 195 | Ga0400483_134954 | |||
| 196 | Ga0400483_207829 | |||
| 197 | Ga0400483_269129 | |||
| 198 | Ga0400489_16533 | |||
| 199 | Ga0400489_37886 | |||
| 200 | Ga0400489_54353 | |||
| 201 | Ga0400489_67717 | |||
| 202 | Ga0400489_81224 | |||
| 203 | Ga0400487_24802 | |||
| 204 | Ga0451577_0000050 | |||
| 205 | Ga0451577_0000398 | |||
| 206 | Ga0451577_0000465 | |||
| 207 | Ga0451577_0001583 | |||
| 208 | Ga0451577_0004892 | |||
| 209 | Ga0451577_0016220 | |||
| 210 | Ga0451577_0061208 | |||
| 211 | Ga0451577_0227537 | |||
| 212 | Ga0453683_0000002 | |||
| 213 | Ga0453683_0000014 | |||
| 214 | Ga0453683_0000053 | |||
| 215 | Ga0453683_0000098 | |||
| 216 | Ga0453683_0000138 | |||
| 217 | Ga0453683_0000177 | |||
| 218 | Ga0453683_0000566 | |||
| 219 | Ga0453683_0000773 | |||
| 220 | Ga0453683_0000972 | |||
| 221 | Ga0453683_0002281 | |||
| 222 | Ga0453683_0005181 | |||
| 223 | Ga0453683_0008286 | |||
| 224 | Ga0453683_0019398 | |||
| 225 | Ga0453683_0028524 | |||
| 226 | Ga0453683_0035615 | |||
| 227 | Ga0453684_0000061 | |||
| 228 | Ga0453684_0000210 | |||
| 229 | Ga0453684_0000486 | |||
| 230 | Ga0453684_0000551 | |||
| 231 | Ga0453684_0000619 | |||
| 232 | Ga0453684_0001180 | |||
| 233 | Ga0453684_0001383 | |||
| 234 | Ga0453684_0001665 | |||
| 235 | Ga0453684_0004116 | |||
| 236 | Ga0453684_0004728 | |||
| 237 | Ga0453684_0006292 | |||
| 238 | Ga0453684_0008485 | |||
| 239 | Ga0453684_0009498 | |||
| 240 | Ga0453684_0023012 | |||
| 241 | Ga0453684_0024878 | |||
| 242 | Ga0453684_0035529 | |||
| 243 | Ga0453684_0041237 | |||
| 244 | Ga0453684_0051247 | |||
| 245 | Ga0453684_0055332 | |||
| 246 | Ga0453684_0058281 | |||
| 247 | Ga0453684_0074726 | |||
| 248 | Ga0453684_0078777 | |||
| 249 | Ga0453684_0087771 | |||
| 250 | Ga0453684_0144027 | |||
| 251 | Ga0453684_0224240 | |||
| 252 | Ga0453684_0299942 | |||
| 253 | Ga0453684_0428476 | |||
| 254 | Ga0451576_0000001 | |||
| 255 | Ga0451576_0000257 | |||
| 256 | Ga0451576_0000566 | |||
| 257 | Ga0451576_0000573 | |||
| 258 | Ga0451576_0000956 | |||
| 259 | Ga0451576_0001317 | |||
| 260 | Ga0451576_0001815 | |||
| 261 | Ga0451576_0058315 | |||
| 262 | Ga0451576_0188527 | |||
| 263 | Ga0451576_0333117 | |||
| 264 | 2740991634 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kp1-assembly1.cif.gz_A | crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) | 0.9108 | 2 | 425 |
| 4kp2-assembly1.cif.gz_B-2 | crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) | 0.9099 | 4 | 421 |
| 4kp1-assembly1.cif.gz_A | crystal structure of ipm isomerase large subunit from methanococcus jannaschii (mj0499) | 0.9067 | 2 | 425 |
| 4nqy-assembly1.cif.gz_A | the reduced form of mj0499 | 0.9025 | 4 | 424 |
| 4kp2-assembly1.cif.gz_B-2 | crystal structure of homoaconitase large subunit from methanococcus jannaschii (mj1003) | 0.9021 | 4 | 421 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kp2B02 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9649 | 286 | 421 | 3.30.499.10 |
| af_Q9UT74_348_492_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9621 | 297 | 420 | 3.30.499.10 |
| af_P0A6A6_327_466_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9613 | 295 | 427 | 3.30.499.10 |
| af_O14289_312_505_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9247 | 288 | 426 | 3.30.499.10 |
| af_O14289_10_298_3.30.499.10 | Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 | 0.9131 | 4 | 273 | 3.30.499.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9VBJ5-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9939 | 153 | 232 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |
| AF-A0A2N6DUL7-F1-model_v4 | 3-isopropylmalate dehydratase | 0.9923 | 156 | 425 |
GO:0016829
GO:0019752 GO:0046872 GO:0051536 |
| AF-A0A2N6DUL7-F1-model_v4 | 3-isopropylmalate dehydratase | 0.9814 | 156 | 425 |
GO:0016829
GO:0019752 GO:0046872 GO:0051536 |
| AF-A0A2N2ARV8-F1-model_v4 | deleted | 0.9804 | 276 | 422 |
|
| AF-A5G7U4-F1-model_v4 | 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) | 0.9783 | 1 | 427 |
GO:0003861
GO:0009098 GO:0046872 GO:0051539 |