F153443

General Info

Members Datasets Scaffolds Average Seq Length
132 109 129 150

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0119219|Ga0373943_0119219_718_1206
Length 162
Sequence MRALIQRVSEASVEVAGQVVSRIGQGFLVFVAAEKGDGAPEAEETARKIAGLRIFSDEQGRMNRSLADVAGAVLAVSQFTLVADLSRGRRPGFEKALAGSEAQPLYEHFCAALELAGVPVARGVFGADMRVSLVNDGPATFVMDVGGREVTERSPTLRAEPS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221696 Nocardioides sp. Root140 Isolate Unclassified
4 2739367898 Nocardioides sp. CF479 Isolate Unclassified
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
82 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
98 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 0
Rhizoplane 0.76
Rhizosphere 76.52
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2255685 2162886007 Bacteria 19658
2 JGI24033J26618_1006323 3300002155 Bacteria 1327
3 JGI25157J39369_1015070 3300002741 Unclassified 954
4 JGI25150J39212_1000013 3300002774 Bacteria 182307
5 JGI25151J46595_10000004 3300003187 Bacteria 494006
6 JGI25153J46596_10000004 3300003215 Bacteria 494006
7 rootH2_10018141 3300003320 Bacteria 8135
8 rootH2_10249572 3300003320 Bacteria 1827
9 rootH1_10001478 3300003323 Bacteria 3320
10 rootH1_10115215 3300003323 Bacteria 4160
11 rootH1_10136665 3300003323 Bacteria 4865
12 Ga0065714_10095945 3300005288 Bacteria 1773
13 Ga0065714_10323528 3300005288 Bacteria 666
14 Ga0065704_10000425 3300005289 Bacteria 76756
15 Ga0070658_10002554 3300005327 Bacteria 15180
16 Ga0070670_100007147 3300005331 Bacteria 9455
17 Ga0070680_101112849 3300005336 Bacteria 683
18 Ga0070660_100190303 3300005339 Bacteria 1662
19 Ga0070661_100037854 3300005344 Bacteria 3510
20 Ga0070661_100154870 3300005344 Bacteria 1734
21 Ga0070674_101123423 3300005356 Bacteria 695
22 Ga0070698_100020377 3300005471 Bacteria 6950
23 Ga0070697_101880057 3300005536 Bacteria 536
24 Ga0070686_100050571 3300005544 Bacteria 2642
25 Ga0070664_100032228 3300005564 Bacteria 4383
26 Ga0070664_100064677 3300005564 Bacteria 3120
27 Ga0068857_100532576 3300005577 Bacteria 1105
28 Ga0068854_101047107 3300005578 Bacteria 725
29 Ga0068859_100126700 3300005617 Bacteria 2623
30 Ga0068859_100419135 3300005617 Bacteria 1435
31 Ga0068870_10048316 3300005840 Bacteria 2240
32 Ga0075365_10161349 3300006038 Bacteria 1562
33 Ga0075363_100504609 3300006048 Bacteria 719
34 Ga0075364_10022136 3300006051 Bacteria 4011
35 Ga0070716_101213337 3300006173 Bacteria 606
36 Ga0075370_10293962 3300006353 Bacteria 965
37 Ga0068871_101888253 3300006358 Bacteria 568
38 Ga0075428_100002191 3300006844 Bacteria 21126
39 Ga0097620_100126702 3300006931 Bacteria 2623
40 Ga0097620_100419119 3300006931 Bacteria 1435
41 Ga0105240_11853824 3300009093 Unclassified 628
42 Ga0111539_10016838 3300009094 Bacteria 9054
43 Ga0111539_11102612 3300009094 Unclassified 922
44 Ga0105239_10936421 3300010375 Bacteria 995
45 Ga0157373_10003105 3300013100 Bacteria 12551
46 Ga0157373_10032675 3300013100 Bacteria 3745
47 Ga0157371_10005385 3300013102 Bacteria 10807
48 Ga0157370_10000591 3300013104 Bacteria 45316
49 Ga0157370_10053400 3300013104 Bacteria 3853
50 Ga0157370_10114672 3300013104 Bacteria 2517
51 Ga0157375_11403079 3300013308 Bacteria 823
52 Ga0182008_10225063 3300014497 Bacteria 961
53 Ga0182006_1002331 3300015261 Bacteria 10444
54 Ga0163161_10444745 3300017792 Unclassified 1047
55 Ga0207425_1000008 3300025245 Bacteria 618024
56 Ga0209026_1003283 3300025250 Bacteria 5411
57 Ga0209129_1000042 3300025258 Bacteria 305537
58 Ga0209025_1000020 3300025294 Bacteria 618024
59 Ga0209758_1000022 3300025297 Bacteria 618024
60 Ga0207647_10006877 3300025904 Bacteria 8246
61 Ga0207705_10002162 3300025909 Bacteria 15224
62 Ga0207684_10283789 3300025910 Unclassified 1428
63 Ga0207707_10072897 3300025912 Bacteria 2994
64 Ga0207660_10282924 3300025917 Bacteria 1317
65 Ga0207657_10032081 3300025919 Bacteria 4750
66 Ga0207649_10013100 3300025920 Bacteria 4624
67 Ga0207649_10258474 3300025920 Bacteria 1257
68 Ga0207650_10053776 3300025925 Bacteria 2985
69 Ga0207670_11187115 3300025936 Bacteria 646
70 Ga0207669_10387997 3300025937 Bacteria 1090
71 Ga0207679_10018132 3300025945 Bacteria 4709
72 Ga0207679_10084175 3300025945 Bacteria 2440
73 Ga0207668_10432674 3300025972 Bacteria 1119
74 Ga0207640_11533016 3300025981 Bacteria 599
75 Ga0207674_10020510 3300026116 Bacteria 7139
76 Ga0207428_10103099 3300027907 Bacteria 2202
77 Ga0316576_10074531 3300031727 Bacteria 2510
78 Ga0307405_10054918 3300031731 Bacteria 2490
79 Ga0307406_10279857 3300031901 Bacteria 1272
80 Ga0307407_10095609 3300031903 Bacteria 1832
81 Ga0307412_10000001 3300031911 Bacteria 822691
82 Ga0307412_10000093 3300031911 Bacteria 75863
83 Ga0307412_10065577 3300031911 Unclassified 2458
84 Ga0307409_100111300 3300031995 Bacteria 2296
85 Ga0307416_100000368 3300032002 Bacteria 23473
86 Ga0307414_10007079 3300032004 Bacteria 6291
87 Ga0307414_10021383 3300032004 Bacteria 4058
88 Ga0307414_10837935 3300032004 Bacteria 840
89 Ga0307411_10649451 3300032005 Unclassified 913
90 Ga0307415_100002639 3300032126 Bacteria 8939
91 Ga0307415_101111950 3300032126 Bacteria 740
92 Ga0373943_0119219 3300035170 Bacteria 1401
93 Ga0395899_0000021 3300037312 Bacteria 391702
94 Ga0395900_0047944 3300037418 Bacteria 4401
95 Ga0436364_0580151 3300037853 Bacteria 9229
96 Ga0436365_0329583 3300039437 Bacteria 52503
97 Ga0450907_007939 3300042146 Bacteria 1767
98 Ga0450893_0001342 3300042532 Bacteria 3740
99 Ga0495621_0165332 3300046539 Bacteria 877
100 Ga0495668_0000106 3300046616 Bacteria 133476
101 Ga0495668_0199636 3300046616 Unclassified 1095
102 Ga0495588_0377885 3300046674 Bacteria 744
103 Ga0495647_0132596 3300046681 Bacteria 1057
104 Ga0495658_0031893 3300046683 Bacteria 2873
105 Ga0495581_0107123 3300047315 Bacteria 1625
106 Ga0496114_0026433 3300048917 Bacteria 4752
107 Ga0496121_0036793 3300048924 Bacteria 4357
108 Ga0501032_0010521 3300049569 Bacteria 6674
109 Ga0501033_0628146 3300049570 Bacteria 735
110 Ga0501042_0795596 3300049578 Unclassified 688
111 Ga0501069_0044973 3300049585 Bacteria 2445
112 Ga0501072_0023140 3300049588 Bacteria 4825
113 Ga0501073_0074310 3300049589 Bacteria 2367
114 Ga0501217_045290 3300049661 Bacteria 1133
115 Ga0501252_007766 3300049682 Bacteria 1221
116 Ga0501079_0059684 3300049741 Bacteria 2942
117 Ga0501079_1629664 3300049741 Bacteria 507
118 Ga0501080_0083698 3300049742 Bacteria 2964
119 Ga0501081_1306435 3300049743 Unclassified 550
120 Ga0501241_005968 3300049758 Bacteria 2259
121 Ga0501241_007323 3300049758 Bacteria 2022
122 nmdc:mga03n38_198484_c1 3300050490 Bacteria 1037
123 nmdc:mga00v17_32287_c1 3300050491 Bacteria 3093
124 nmdc:mga0yw44_137398_c1 3300050492 Bacteria 1586
125 nmdc:mga08y16_38193_c1 3300050511 Bacteria 5043
126 Ga0500651_0000102 3300053093 Bacteria 52381
127 Ga0500568_0173919 3300053139 Bacteria 792
128 Ga0500568_0188432 3300053139 Bacteria 757
129 Ga0501082_0499742 3300060353 Bacteria 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0026433 Ga0496114_0026433_3987_4379 129
2 3300025937 Ga0207669_10387997 Ga0207669_103879971 133
3 3300025972 Ga0207668_10432674 Ga0207668_104326741 133
4 iso_pu_bacteria 2643221561 2643826372 137
5 iso_pu_bacteria 2643221696 2644532743 137
6 3300005336 Ga0070680_101112849 Ga0070680_1011128491 140
7 3300005339 Ga0070660_100190303 Ga0070660_1001903033 140
8 3300025904 Ga0207647_10006877 Ga0207647_100068775 140
9 3300025912 Ga0207707_10072897 Ga0207707_100728973 140
10 3300025917 Ga0207660_10282924 Ga0207660_102829243 140
11 3300025919 Ga0207657_10032081 Ga0207657_100320816 140
12 3300037853 Ga0436364_0580151 Ga0436364_0580151_5920_6351 140
13 3300039437 Ga0436365_0329583 Ga0436365_0329583_3055_3486 140
14 3300050490 nmdc:mga03n38_198484_c1 nmdc:mga03n38_198484_c1_570_1001 140
15 iso_pu_bacteria 2739367898 2740165957 140
16 3300006048 Ga0075363_100504609 Ga0075363_1005046091 141
17 3300010375 Ga0105239_10936421 Ga0105239_109364211 141
18 3300050492 nmdc:mga0yw44_137398_c1 nmdc:mga0yw44_137398_c1_716_1150 141
19 3300032126 Ga0307415_101111950 Ga0307415_1011119502 142
20 3300049585 Ga0501069_0044973 Ga0501069_0044973_1395_1823 142
21 3300049741 Ga0501079_1629664 Ga0501079_1629664_47_484 142
22 3300006051 Ga0075364_10022136 Ga0075364_100221363 143
23 3300042146 Ga0450907_007939 Ga0450907_007939_167_598 143
24 3300050491 nmdc:mga00v17_32287_c1 nmdc:mga00v17_32287_c1_1826_2269 143
25 3300006038 Ga0075365_10161349 Ga0075365_101613493 144
26 3300053139 Ga0500568_0173919 Ga0500568_0173919_227_667 144
27 3300005331 Ga0070670_100007147 Ga0070670_1000071476 145
28 3300005356 Ga0070674_101123423 Ga0070674_1011234232 145
29 3300005471 Ga0070698_100020377 Ga0070698_1000203774 145
30 3300005536 Ga0070697_101880057 Ga0070697_1018800571 145
31 3300005577 Ga0068857_100532576 Ga0068857_1005325762 145
32 3300005840 Ga0068870_10048316 Ga0068870_100483162 145
33 3300006173 Ga0070716_101213337 Ga0070716_1012133372 145
34 3300009093 Ga0105240_11853824 Ga0105240_118538241 145
35 3300025910 Ga0207684_10283789 Ga0207684_102837892 145
36 3300025925 Ga0207650_10053776 Ga0207650_100537763 145
37 3300026116 Ga0207674_10020510 Ga0207674_100205102 145
38 3300049570 Ga0501033_0628146 Ga0501033_0628146_253_696 147
39 3300049578 Ga0501042_0795596 Ga0501042_0795596_47_490 147
40 3300049588 Ga0501072_0023140 Ga0501072_0023140_3491_3934 147
41 3300049741 Ga0501079_0059684 Ga0501079_0059684_2345_2788 147
42 3300049742 Ga0501080_0083698 Ga0501080_0083698_1242_1685 147
43 3300049743 Ga0501081_1306435 Ga0501081_1306435_89_532 147
44 3300060353 Ga0501082_0499742 Ga0501082_0499742_518_961 147
45 3300035170 Ga0373943_0119219 Ga0373943_0119219_718_1206 149
46 3300046674 Ga0495588_0377885 Ga0495588_0377885_245_733 149
47 3300046681 Ga0495647_0132596 Ga0495647_0132596_216_704 149
48 3300046683 Ga0495658_0031893 Ga0495658_0031893_1790_2278 149
49 3300047315 Ga0495581_0107123 Ga0495581_0107123_722_1210 149
50 2162886007 SwRhRL2b_contig_2255685 SwRhRL2b_0652.00005780 150
51 3300002155 JGI24033J26618_1006323 JGI24033J26618_10063232 150
52 3300002741 JGI25157J39369_1015070 JGI25157J39369_10150701 150
53 3300002774 JGI25150J39212_1000013 JGI25150J39212_1000013106 150
54 3300003187 JGI25151J46595_10000004 JGI25151J46595_1000000464 150
55 3300003215 JGI25153J46596_10000004 JGI25153J46596_1000000464 150
56 3300003320 rootH2_10018141 rootH2_100181416 150
57 3300003320 rootH2_10249572 rootH2_102495722 150
58 3300003323 rootH1_10001478 rootH1_100014782 150
59 3300003323 rootH1_10115215 rootH1_101152152 150
60 3300003323 rootH1_10136665 rootH1_101366652 150
61 3300005288 Ga0065714_10095945 Ga0065714_100959452 150
62 3300005288 Ga0065714_10323528 Ga0065714_103235281 150
63 3300005289 Ga0065704_10000425 Ga0065704_100004259 150
64 3300005327 Ga0070658_10002554 Ga0070658_1000255414 150
65 3300005344 Ga0070661_100037854 Ga0070661_1000378542 150
66 3300005344 Ga0070661_100154870 Ga0070661_1001548701 150
67 3300005544 Ga0070686_100050571 Ga0070686_1000505712 150
68 3300005564 Ga0070664_100032228 Ga0070664_1000322281 150
69 3300005564 Ga0070664_100064677 Ga0070664_1000646772 150
70 3300005578 Ga0068854_101047107 Ga0068854_1010471072 150
71 3300005617 Ga0068859_100126700 Ga0068859_1001267002 150
72 3300005617 Ga0068859_100419135 Ga0068859_1004191351 150
73 3300006353 Ga0075370_10293962 Ga0075370_102939621 150
74 3300006358 Ga0068871_101888253 Ga0068871_1018882531 150
75 3300006844 Ga0075428_100002191 Ga0075428_1000021919 150
76 3300006931 Ga0097620_100126702 Ga0097620_1001267022 150
77 3300006931 Ga0097620_100419119 Ga0097620_1004191193 150
78 3300009094 Ga0111539_10016838 Ga0111539_100168382 150
79 3300009094 Ga0111539_11102612 Ga0111539_111026122 150
80 3300013100 Ga0157373_10003105 Ga0157373_100031053 150
81 3300013100 Ga0157373_10032675 Ga0157373_100326754 150
82 3300013102 Ga0157371_10005385 Ga0157371_100053858 150
83 3300013104 Ga0157370_10000591 Ga0157370_1000059115 150
84 3300013104 Ga0157370_10053400 Ga0157370_100534004 150
85 3300013104 Ga0157370_10114672 Ga0157370_101146723 150
86 3300013308 Ga0157375_11403079 Ga0157375_114030791 150
87 3300014497 Ga0182008_10225063 Ga0182008_102250632 150
88 3300015261 Ga0182006_1002331 Ga0182006_10023313 150
89 3300017792 Ga0163161_10444745 Ga0163161_104447451 150
90 3300025245 Ga0207425_1000008 Ga0207425_1000008368 150
91 3300025250 Ga0209026_1003283 Ga0209026_10032833 150
92 3300025258 Ga0209129_1000042 Ga0209129_1000042103 150
93 3300025294 Ga0209025_1000020 Ga0209025_1000020368 150
94 3300025297 Ga0209758_1000022 Ga0209758_1000022368 150
95 3300025909 Ga0207705_10002162 Ga0207705_1000216214 150
96 3300025920 Ga0207649_10013100 Ga0207649_100131003 150
97 3300025920 Ga0207649_10258474 Ga0207649_102584742 150
98 3300025936 Ga0207670_11187115 Ga0207670_111871151 150
99 3300025945 Ga0207679_10018132 Ga0207679_100181322 150
100 3300025945 Ga0207679_10084175 Ga0207679_100841752 150
101 3300025981 Ga0207640_11533016 Ga0207640_115330161 150
102 3300027907 Ga0207428_10103099 Ga0207428_101030992 150
103 3300031727 Ga0316576_10074531 Ga0316576_100745314 150
104 3300031731 Ga0307405_10054918 Ga0307405_100549184 150
105 3300031901 Ga0307406_10279857 Ga0307406_102798571 150
106 3300031903 Ga0307407_10095609 Ga0307407_100956093 150
107 3300031911 Ga0307412_10000001 Ga0307412_1000000145 150
108 3300031911 Ga0307412_10000093 Ga0307412_1000009345 150
109 3300031911 Ga0307412_10065577 Ga0307412_100655772 150
110 3300031995 Ga0307409_100111300 Ga0307409_1001113005 150
111 3300032002 Ga0307416_100000368 Ga0307416_10000036812 150
112 3300032004 Ga0307414_10007079 Ga0307414_100070795 150
113 3300032004 Ga0307414_10021383 Ga0307414_100213832 150
114 3300032004 Ga0307414_10837935 Ga0307414_108379352 150
115 3300032005 Ga0307411_10649451 Ga0307411_106494512 150
116 3300032126 Ga0307415_100002639 Ga0307415_10000263912 150
117 3300037312 Ga0395899_0000021 Ga0395899_0000021_384281_384733 150
118 3300037418 Ga0395900_0047944 Ga0395900_0047944_74_526 150
119 3300042532 Ga0450893_0001342 Ga0450893_0001342_3084_3698 150
120 3300046539 Ga0495621_0165332 Ga0495621_0165332_296_748 150
121 3300046616 Ga0495668_0000106 Ga0495668_0000106_247_699 150
122 3300046616 Ga0495668_0199636 Ga0495668_0199636_578_1030 150
123 3300048924 Ga0496121_0036793 Ga0496121_0036793_3411_3863 150
124 3300049569 Ga0501032_0010521 Ga0501032_0010521_2030_2482 150
125 3300049589 Ga0501073_0074310 Ga0501073_0074310_105_557 150
126 3300049661 Ga0501217_045290 Ga0501217_045290_239_700 150
127 3300049682 Ga0501252_007766 Ga0501252_007766_293_745 150
128 3300049758 Ga0501241_005968 Ga0501241_005968_439_891 150
129 3300049758 Ga0501241_007323 Ga0501241_007323_42_494 150
130 3300050511 nmdc:mga08y16_38193_c1 nmdc:mga08y16_38193_c1_3650_4102 150
131 3300053093 Ga0500651_0000102 Ga0500651_0000102_51550_52002 150
132 3300053139 Ga0500568_0188432 Ga0500568_0188432_294_746 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9665 1 147
3kod-assembly2.cif.gz_C dtd from plasmodium falciparum in complex with d-serine 0.9653 1 148
3lmv-assembly3.cif.gz_F d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9634 1 148
3ko3-assembly2.cif.gz_C d-tyrosyl-trna(tyr) deacylase from plasmodium falciparum incomplex with adp, obtained through soaking native enzyme crystal with the atp 0.963 1 147
3lmv-assembly2.cif.gz_C d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9619 1 148
ID Description Score Start End Superfamily
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9804 1 147 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9783 1 147 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9665 1 147 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9655 1 145 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9628 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A562MVL7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9958 2 149 GO:0000049
GO:0005737
GO:0016020
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6A5L4H2-F1-model_v4 deleted 0.9953 1 150
AF-A0A816XGZ0-F1-model_v4 D-aminoacyl-tRNA deacylase (EC 3.1.1.96) 0.9945 1 147 GO:0000049
GO:0004820
GO:0005524
GO:0005737
GO:0006426
GO:0016020
GO:0051499
AF-A0A5Q5G703-F1-model_v4 deleted 0.9943 2 150
AF-A0A841JMQ7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9941 1 150 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Feature Viewer

pLDDT pTM Quality
95.86 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map