F153309

General Info

Members Datasets Scaffolds Average Seq Length
132 109 264 99

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10137437|Ga0265327_101374372
Length 111
Sequence MMSETKGGGAAIRVALPFHLRTLAKIDVPEVTLQIAAPVTVGRVIDALEARYPMLAGTIREHDTGKRRAFMRVFACEEDWSHEPMDKPLPEAVAEGREALIILGAIAGGTE

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.15
Metatranscriptomes 9.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.27
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10137437 3300031251 Bacteria 1145
2 JGI25406J46586_10019852 3300003203 Bacteria 2730
3 JGI25405J52794_10078914 3300003911 Bacteria 723
4 Ga0058861_10011440 3300004800 Bacteria 1957
5 Ga0058862_10025361 3300004803 Bacteria 3708
6 Ga0070683_100010724 3300005329 Bacteria 7881
7 Ga0070670_101948957 3300005331 Bacteria 541
8 Ga0070680_100035035 3300005336 Bacteria 4051
9 Ga0070680_100961540 3300005336 Bacteria 737
10 Ga0068868_100655191 3300005338 Bacteria 935
11 Ga0070708_101514518 3300005445 Bacteria 625
12 Ga0070663_100215973 3300005455 Bacteria 1504
13 Ga0070684_100193997 3300005535 Bacteria 1849
14 Ga0070697_100124123 3300005536 Bacteria 2162
15 Ga0070697_100416796 3300005536 Bacteria 1167
16 Ga0068853_100407063 3300005539 Unclassified 1274
17 Ga0070693_100947920 3300005547 Bacteria 648
18 Ga0070702_101414131 3300005615 Bacteria 569
19 Ga0081455_10066475 3300005937 Bacteria 3011
20 Ga0081539_10000424 3300005985 Bacteria 89967
21 Ga0070717_10349370 3300006028 Bacteria 1322
22 Ga0070716_100362209 3300006173 Bacteria 1030
23 Ga0075428_102550081 3300006844 Bacteria 523
24 Ga0075436_100037278 3300006914 Bacteria 3356
25 Ga0075436_100916505 3300006914 Bacteria 656
26 Ga0105241_10220662 3300009174 Bacteria 1593
27 Ga0105237_10001475 3300009545 Bacteria 31009
28 Ga0105238_10831793 3300009551 Bacteria 940
29 Ga0105239_10005217 3300010375 Bacteria 15292
30 Ga0157339_1019630 3300012505 Bacteria 707
31 Ga0157369_10004520 3300013105 Bacteria 16370
32 Ga0157374_10001525 3300013296 Bacteria 19503
33 Ga0157374_10052728 3300013296 Unclassified 3789
34 Ga0157378_10417486 3300013297 Bacteria 1325
35 Ga0157372_10143547 3300013307 Bacteria 2753
36 Ga0197907_10291974 3300020069 Bacteria 3416
37 Ga0206356_11518745 3300020070 Bacteria 619
38 Ga0206349_1209537 3300020075 Bacteria 2583
39 Ga0206351_10723106 3300020077 Bacteria 1048
40 Ga0206352_10240072 3300020078 Bacteria 3873
41 Ga0206350_10169733 3300020080 Bacteria 3125
42 Ga0206354_10022903 3300020081 Bacteria 1596
43 Ga0206353_10872084 3300020082 Bacteria 1067
44 Ga0154015_1639419 3300020610 Bacteria 1269
45 Ga0213875_10000001 3300021388 Bacteria 2793540
46 Ga0213875_10008920 3300021388 Bacteria 5112
47 Ga0213875_10043622 3300021388 Bacteria 2106
48 Ga0213875_10476049 3300021388 Bacteria 599
49 Ga0224712_10000486 3300022467 Bacteria 7964
50 Ga0207699_11012798 3300025906 Bacteria 614
51 Ga0207684_10823448 3300025910 Bacteria 784
52 Ga0207654_10174217 3300025911 Unclassified 1399
53 Ga0207707_10011546 3300025912 Bacteria 7690
54 Ga0207671_10012188 3300025914 Bacteria 6935
55 Ga0207660_10028343 3300025917 Bacteria 3830
56 Ga0207652_10027355 3300025921 Bacteria 4751
57 Ga0207646_10681101 3300025922 Bacteria 920
58 Ga0207694_10565604 3300025924 Bacteria 955
59 Ga0207691_10931208 3300025940 Bacteria 727
60 Ga0207661_10033221 3300025944 Bacteria 4003
61 Ga0207639_10467116 3300026041 Unclassified 1148
62 Ga0207708_11054253 3300026075 Bacteria 708
63 Ga0207698_10662609 3300026142 Bacteria 1035
64 Ga0268266_10403258 3300028379 Bacteria 1293
65 Ga0268264_10773422 3300028381 Bacteria 958
66 Ga0265771_1003489 3300031010 Bacteria 908
67 Ga0265330_10069164 3300031235 Bacteria 1528
68 Ga0265330_10359339 3300031235 Bacteria 615
69 Ga0265325_10038951 3300031241 Bacteria 2506
70 Ga0265325_10089103 3300031241 Bacteria 1524
71 Ga0265325_10119055 3300031241 Bacteria 1275
72 Ga0265340_10056103 3300031247 Bacteria 1896
73 Ga0265339_10027473 3300031249 Bacteria 3248
74 Ga0265339_10082748 3300031249 Bacteria 1694
75 Ga0265327_10384931 3300031251 Bacteria 610
76 Ga0265316_10109614 3300031344 Bacteria 2092
77 Ga0265316_10176649 3300031344 Bacteria 1591
78 Ga0265316_10239190 3300031344 Bacteria 1335
79 Ga0265313_10030947 3300031595 Bacteria 2749
80 Ga0265342_10025216 3300031712 Bacteria 3742
81 Ga0316576_10558918 3300031727 Unclassified 838
82 Ga0316578_10063387 3300031728 Bacteria 2180
83 Ga0307516_10454607 3300031730 Bacteria 936
84 Ga0307409_101882515 3300031995 Bacteria 628
85 Ga0307409_102220531 3300031995 Bacteria 578
86 Ga0373926_0444505 3300035083 Unclassified 514
87 Ga0316574_0108915 3300035398 Bacteria 1775
88 Ga0373927_0419178 3300035695 Bacteria 884
89 Ga0395898_0319976 3300037466 Bacteria 1480
90 Ga0395898_0915443 3300037466 Bacteria 815
91 Ga0395905_0269413 3300037471 Bacteria 1589
92 Ga0436364_0273345 3300037853 Bacteria 2794207
93 Ga0436364_0413399 3300037853 Bacteria 3736
94 Ga0436364_0748068 3300037853 Bacteria 528910
95 Ga0436364_0860100 3300037853 Unclassified 1624
96 Ga0436364_1109422 3300037853 Bacteria 13505
97 Ga0395901_0808152 3300038443 Bacteria 926
98 Ga0439439_0017546 3300041406 Bacteria 1761
99 Ga0451853_1857580 3300041512 Bacteria 794
100 Ga0439433_0186169 3300041999 Bacteria 545
101 Ga0439457_064506 3300042014 Bacteria 831
102 Ga0439446_0089323 3300042156 Bacteria 963
103 Ga0439458_0231527 3300042157 Unclassified 511
104 Ga0439434_0102134 3300042435 Bacteria 924
105 Ga0451577_0342099 3300042876 Bacteria 1357
106 Ga0451577_0762225 3300042876 Bacteria 875
107 Ga0451576_0997249 3300045051 Bacteria 878
108 Ga0495592_0265377 3300046454 Bacteria 1129
109 Ga0495653_0260746 3300046463 Bacteria 1146
110 Ga0495580_0874576 3300046472 Bacteria 579
111 Ga0495639_0177495 3300046475 Bacteria 1036
112 Ga0495664_0257655 3300046477 Bacteria 1055
113 Ga0495618_0233717 3300046514 Bacteria 1157
114 Ga0495645_0261122 3300046543 Bacteria 1147
115 Ga0495645_0693645 3300046543 Bacteria 619
116 Ga0495635_0900759 3300046663 Unclassified 566
117 Ga0495613_0873250 3300046689 Unclassified 583
118 Ga0495600_0186185 3300046809 Bacteria 1337
119 Ga0495581_0097714 3300047315 Unclassified 1706
120 Ga0495674_0008960 3300047319 Bacteria 9509
121 Ga0495684_0039996 3300047471 Bacteria 3595
122 Ga0495602_0156781 3300048088 Bacteria 1782
123 Ga0496104_0227751 3300048907 Unclassified 1776
124 Ga0496105_0373216 3300048908 Bacteria 1136
125 Ga0496109_1187453 3300048912 Unclassified 700
126 Ga0501034_0189379 3300049571 Bacteria 2020
127 Ga0501036_0362071 3300049572 Bacteria 1211
128 Ga0501036_0449936 3300049572 Bacteria 1073
129 Ga0501047_0033764 3300049581 Bacteria 4938
130 Ga0501048_0745229 3300049582 Bacteria 704
131 Ga0501075_0381281 3300049591 Bacteria 1075
132 Ga0501044_0448384 3300049823 Bacteria 1197
133 Ga0265327_10137437
134 JGI25406J46586_10019852
135 JGI25405J52794_10078914
136 Ga0058861_10011440
137 Ga0058862_10025361
138 Ga0070683_100010724
139 Ga0070670_101948957
140 Ga0070680_100035035
141 Ga0070680_100961540
142 Ga0068868_100655191
143 Ga0070708_101514518
144 Ga0070663_100215973
145 Ga0070684_100193997
146 Ga0070697_100124123
147 Ga0070697_100416796
148 Ga0068853_100407063
149 Ga0070693_100947920
150 Ga0070702_101414131
151 Ga0081455_10066475
152 Ga0081539_10000424
153 Ga0070717_10349370
154 Ga0070716_100362209
155 Ga0075428_102550081
156 Ga0075436_100037278
157 Ga0075436_100916505
158 Ga0105241_10220662
159 Ga0105237_10001475
160 Ga0105238_10831793
161 Ga0105239_10005217
162 Ga0157339_1019630
163 Ga0157369_10004520
164 Ga0157374_10001525
165 Ga0157374_10052728
166 Ga0157378_10417486
167 Ga0157372_10143547
168 Ga0197907_10291974
169 Ga0206356_11518745
170 Ga0206349_1209537
171 Ga0206351_10723106
172 Ga0206352_10240072
173 Ga0206350_10169733
174 Ga0206354_10022903
175 Ga0206353_10872084
176 Ga0154015_1639419
177 Ga0213875_10000001
178 Ga0213875_10008920
179 Ga0213875_10043622
180 Ga0213875_10476049
181 Ga0224712_10000486
182 Ga0207699_11012798
183 Ga0207684_10823448
184 Ga0207654_10174217
185 Ga0207707_10011546
186 Ga0207671_10012188
187 Ga0207660_10028343
188 Ga0207652_10027355
189 Ga0207646_10681101
190 Ga0207694_10565604
191 Ga0207691_10931208
192 Ga0207661_10033221
193 Ga0207639_10467116
194 Ga0207708_11054253
195 Ga0207698_10662609
196 Ga0268266_10403258
197 Ga0268264_10773422
198 Ga0265771_1003489
199 Ga0265330_10069164
200 Ga0265330_10359339
201 Ga0265325_10038951
202 Ga0265325_10089103
203 Ga0265325_10119055
204 Ga0265340_10056103
205 Ga0265339_10027473
206 Ga0265339_10082748
207 Ga0265327_10384931
208 Ga0265316_10109614
209 Ga0265316_10176649
210 Ga0265316_10239190
211 Ga0265313_10030947
212 Ga0265342_10025216
213 Ga0316576_10558918
214 Ga0316578_10063387
215 Ga0307516_10454607
216 Ga0307409_101882515
217 Ga0307409_102220531
218 Ga0373926_0444505
219 Ga0316574_0108915
220 Ga0373927_0419178
221 Ga0395898_0319976
222 Ga0395898_0915443
223 Ga0395905_0269413
224 Ga0436364_0273345
225 Ga0436364_0413399
226 Ga0436364_0748068
227 Ga0436364_0860100
228 Ga0436364_1109422
229 Ga0395901_0808152
230 Ga0439439_0017546
231 Ga0451853_1857580
232 Ga0439433_0186169
233 Ga0439457_064506
234 Ga0439446_0089323
235 Ga0439458_0231527
236 Ga0439434_0102134
237 Ga0451577_0342099
238 Ga0451577_0762225
239 Ga0451576_0997249
240 Ga0495592_0265377
241 Ga0495653_0260746
242 Ga0495580_0874576
243 Ga0495639_0177495
244 Ga0495664_0257655
245 Ga0495618_0233717
246 Ga0495645_0261122
247 Ga0495645_0693645
248 Ga0495635_0900759
249 Ga0495613_0873250
250 Ga0495600_0186185
251 Ga0495581_0097714
252 Ga0495674_0008960
253 Ga0495684_0039996
254 Ga0495602_0156781
255 Ga0496104_0227751
256 Ga0496105_0373216
257 Ga0496109_1187453
258 Ga0501034_0189379
259 Ga0501036_0362071
260 Ga0501036_0449936
261 Ga0501047_0033764
262 Ga0501048_0745229
263 Ga0501075_0381281
264 Ga0501044_0448384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8679 3 98
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8672 3 95
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8359 1 98
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8333 3 98
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8276 1 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8674 3 95 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8359 1 98 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8276 1 98 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8266 1 98 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8233 3 93 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9902 2 94
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9869 1 84
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9864 2 85
AF-A0A653EFW6-F1-model_v4 ThiS family protein 0.9843 2 98
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9836 1 46

Map