F152330

General Info

Members Datasets Scaffolds Average Seq Length
132 102 264 267

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10062100|Ga0075366_100621003
Length 287
Sequence MLPRTLLSWLASGNEAFVAANEDAEAPADDPGLLAAVVKPFYTGLDQIGRIVELTWQTLAWMIRPPYRLIQLLLAMDFLGVKSIFIISLTGTFSGMVLALQTVNSLRQFSAEGVVGSIVAISLTREISPVFAALMVTARGGSAMAAELGNMRVTEQIDALTTMGVSPVQYLLAPRLLACVAMLPLLCILYTCVGMAGSWVVAVDWLSVDPGIFISNIEKYLMPKDLYMGAIKSLVFGFLVSAISCTQGYYASGGAKGVGEATTRAVVLSAVAILVTNYVLTSWLTEL

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
78 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
100 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.06
Nodule 0
Rhizoplane 3.03
Rhizosphere 77.27
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10062100 3300006195 Bacteria 2221
2 rootH2_10004677 3300003320 Bacteria 17390
3 rootH2_10081904 3300003320 Bacteria 3014
4 rootL2_10022789 3300003322 Bacteria 4146
5 rootL2_10147805 3300003322 Unclassified 1814
6 rootH1_10015270 3300003323 Bacteria 16564
7 rootH1_10063310 3300003323 Bacteria 4650
8 Ga0070683_100144991 3300005329 Bacteria 2250
9 Ga0070682_100001360 3300005337 Bacteria 13798
10 Ga0070682_100003634 3300005337 Bacteria 8549
11 Ga0070682_100017356 3300005337 Bacteria 4194
12 Ga0070682_100182807 3300005337 Bacteria 1466
13 Ga0070668_100045356 3300005347 Bacteria 3373
14 Ga0070705_100082915 3300005440 Bacteria 1974
15 Ga0070700_100224848 3300005441 Bacteria 1332
16 Ga0070663_100002005 3300005455 Bacteria 11374
17 Ga0068867_100062473 3300005459 Bacteria 2767
18 Ga0070706_100083447 3300005467 Bacteria 2960
19 Ga0070707_100010100 3300005468 Bacteria 8785
20 Ga0070672_100001516 3300005543 Bacteria 14390
21 Ga0070695_100060223 3300005545 Bacteria 2460
22 Ga0070693_100091430 3300005547 Bacteria 1835
23 Ga0070693_100120031 3300005547 Bacteria 1629
24 Ga0070693_100239614 3300005547 Bacteria 1197
25 Ga0070665_100518119 3300005548 Bacteria 1204
26 Ga0068855_100004591 3300005563 Bacteria 16861
27 Ga0068855_100006451 3300005563 Bacteria 14286
28 Ga0068859_100273094 3300005617 Bacteria 1783
29 Ga0068861_100092859 3300005719 Bacteria 2385
30 Ga0068863_100159042 3300005841 Bacteria 2164
31 Ga0068863_100190469 3300005841 Bacteria 1971
32 Ga0068863_100299846 3300005841 Bacteria 1559
33 Ga0068862_100615421 3300005844 Bacteria 1044
34 Ga0075366_10023288 3300006195 Bacteria 3608
35 Ga0075366_10235869 3300006195 Bacteria 1115
36 Ga0068871_100025010 3300006358 Bacteria 4640
37 Ga0068865_100361353 3300006881 Bacteria 1179
38 Ga0097620_100273093 3300006931 Bacteria 1783
39 Ga0105240_10485241 3300009093 Bacteria 1377
40 Ga0105245_10012466 3300009098 Bacteria 7396
41 Ga0105247_10003021 3300009101 Bacteria 11147
42 Ga0114129_11372988 3300009147 Bacteria 873
43 Ga0105241_10002481 3300009174 Bacteria 13861
44 Ga0105242_10066803 3300009176 Bacteria 2971
45 Ga0157374_10137462 3300013296 Bacteria 2370
46 Ga0163163_10016815 3300014325 Bacteria 6808
47 Ga0157376_10018022 3300014969 Bacteria 5402
48 Ga0157376_10260189 3300014969 Bacteria 1625
49 Ga0207710_10004044 3300025900 Bacteria 6452
50 Ga0207654_10016360 3300025911 Bacteria 3861
51 Ga0207687_10010490 3300025927 Bacteria 6051
52 Ga0207691_10011284 3300025940 Bacteria 8572
53 Ga0207661_10605814 3300025944 Bacteria 1005
54 Ga0207667_10000473 3300025949 Bacteria 53669
55 Ga0207667_10003253 3300025949 Bacteria 20044
56 Ga0207712_10046620 3300025961 Bacteria 3005
57 Ga0207678_10000712 3300026067 Bacteria 30390
58 Ga0207708_10290305 3300026075 Bacteria 1327
59 Ga0207702_10014073 3300026078 Bacteria 6643
60 Ga0207641_10033775 3300026088 Bacteria 4251
61 Ga0207641_10443582 3300026088 Bacteria 1253
62 Ga0207648_10015131 3300026089 Bacteria 7101
63 Ga0207648_10069746 3300026089 Bacteria 3063
64 Ga0207675_100106213 3300026118 Unclassified 2647
65 Ga0207675_100220839 3300026118 Bacteria 1826
66 Ga0268266_10423906 3300028379 Bacteria 1261
67 Ga0265337_1006285 3300028556 Bacteria 4603
68 Ga0265334_10001011 3300028573 Bacteria 13875
69 Ga0265320_10000184 3300031240 Bacteria 52055
70 Ga0265339_10002437 3300031249 Bacteria 13330
71 Ga0265316_10000130 3300031344 Bacteria 81991
72 Ga0307513_10117421 3300031456 Bacteria 2638
73 Ga0307513_10386355 3300031456 Unclassified 1138
74 Ga0307508_10002359 3300031616 Bacteria 19967
75 Ga0307508_10145100 3300031616 Bacteria 1977
76 Ga0316575_10024919 3300031665 Bacteria 2318
77 Ga0265314_10000003 3300031711 Bacteria 1653386
78 Ga0265314_10012277 3300031711 Bacteria 7004
79 Ga0316576_10040623 3300031727 Bacteria 3345
80 Ga0316576_10051016 3300031727 Bacteria 3010
81 Ga0316576_10064472 3300031727 Unclassified 2691
82 Ga0316578_10021223 3300031728 Bacteria 3602
83 Ga0307516_10003525 3300031730 Bacteria 20032
84 Ga0316577_10072982 3300031733 Bacteria 1916
85 Ga0307406_10020314 3300031901 Bacteria 3910
86 Ga0307412_10080594 3300031911 Bacteria 2249
87 Ga0307507_10068318 3300033179 Bacteria 3243
88 Ga0373936_0062124 3300035113 Bacteria 1527
89 Ga0316574_0072205 3300035398 Bacteria 2181
90 Ga0373927_0022903 3300035695 Bacteria 4092
91 Ga0373933_0063274 3300035724 Bacteria 2236
92 Ga0373925_0134194 3300037068 Bacteria 1933
93 Ga0400489_15688 3300039093 Bacteria 4549
94 Ga0436365_0420179 3300039437 Bacteria 7962
95 Ga0439465_0051970 3300041413 Bacteria 1344
96 Ga0451793_1647706 3300041452 Bacteria 1865
97 Ga0451797_1363255 3300041453 Bacteria 1805
98 Ga0451802_0589169 3300041460 Bacteria 2879
99 Ga0451807_0121406 3300041486 Bacteria 1034
100 Ga0451841_1402568 3300041498 Bacteria 1414
101 Ga0451849_1075358 3300041505 Bacteria 3474
102 Ga0451853_4023065 3300041512 Bacteria 6391
103 Ga0439445_0049243 3300042004 Bacteria 1134
104 Ga0439458_0014694 3300042157 Bacteria 1768
105 Ga0451577_0085742 3300042876 Bacteria 2810
106 Ga0451577_0395224 3300042876 Bacteria 1255
107 Ga0466970_0440641 3300044765 Bacteria 746
108 Ga0451576_0447400 3300045051 Bacteria 1356
109 Ga0466967_0067795 3300045976 Bacteria 3184
110 Ga0495660_0199876 3300046810 Bacteria 955
111 Ga0496121_0277906 3300048924 Bacteria 1147
112 Ga0501034_0104920 3300049571 Bacteria 2819
113 Ga0501047_0094030 3300049581 Bacteria 2877
114 Ga0501067_0009529 3300049583 Bacteria 5380
115 Ga0501067_0044582 3300049583 Bacteria 2464
116 Ga0501068_0056958 3300049584 Bacteria 2369
117 Ga0501073_0018169 3300049589 Bacteria 5083
118 Ga0501073_0249119 3300049589 Bacteria 1226
119 Ga0501074_0015591 3300049590 Bacteria 5524
120 Ga0501253_006948 3300049683 Bacteria 1559
121 Ga0501083_0025176 3300049744 Bacteria 4120
122 Ga0501083_0251389 3300049744 Bacteria 1150
123 nmdc:mga0k408_10491_c1 3300050493 Bacteria 5011
124 nmdc:mga0k408_57856_c1 3300050493 Bacteria 2251
125 nmdc:mga0k408_96851_c1 3300050493 Bacteria 1737
126 nmdc:mga09592_611419_c1 3300050508 Bacteria 933
127 nmdc:mga08y16_88201_c1 3300050511 Bacteria 3233
128 Ga0500635_0031308 3300053080 Bacteria 1721
129 Ga0500588_0008387 3300053146 Bacteria 2412
130 Ga0501084_0002285 3300054114 Bacteria 15395
131 Ga0501084_0459723 3300054114 Unclassified 1076
132 Ga0501082_0012521 3300060353 Bacteria 7288
133 Ga0075366_10062100
134 rootH2_10004677
135 rootH2_10081904
136 rootL2_10022789
137 rootL2_10147805
138 rootH1_10015270
139 rootH1_10063310
140 Ga0070683_100144991
141 Ga0070682_100001360
142 Ga0070682_100003634
143 Ga0070682_100017356
144 Ga0070682_100182807
145 Ga0070668_100045356
146 Ga0070705_100082915
147 Ga0070700_100224848
148 Ga0070663_100002005
149 Ga0068867_100062473
150 Ga0070706_100083447
151 Ga0070707_100010100
152 Ga0070672_100001516
153 Ga0070695_100060223
154 Ga0070693_100091430
155 Ga0070693_100120031
156 Ga0070693_100239614
157 Ga0070665_100518119
158 Ga0068855_100004591
159 Ga0068855_100006451
160 Ga0068859_100273094
161 Ga0068861_100092859
162 Ga0068863_100159042
163 Ga0068863_100190469
164 Ga0068863_100299846
165 Ga0068862_100615421
166 Ga0075366_10023288
167 Ga0075366_10235869
168 Ga0068871_100025010
169 Ga0068865_100361353
170 Ga0097620_100273093
171 Ga0105240_10485241
172 Ga0105245_10012466
173 Ga0105247_10003021
174 Ga0114129_11372988
175 Ga0105241_10002481
176 Ga0105242_10066803
177 Ga0157374_10137462
178 Ga0163163_10016815
179 Ga0157376_10018022
180 Ga0157376_10260189
181 Ga0207710_10004044
182 Ga0207654_10016360
183 Ga0207687_10010490
184 Ga0207691_10011284
185 Ga0207661_10605814
186 Ga0207667_10000473
187 Ga0207667_10003253
188 Ga0207712_10046620
189 Ga0207678_10000712
190 Ga0207708_10290305
191 Ga0207702_10014073
192 Ga0207641_10033775
193 Ga0207641_10443582
194 Ga0207648_10015131
195 Ga0207648_10069746
196 Ga0207675_100106213
197 Ga0207675_100220839
198 Ga0268266_10423906
199 Ga0265337_1006285
200 Ga0265334_10001011
201 Ga0265320_10000184
202 Ga0265339_10002437
203 Ga0265316_10000130
204 Ga0307513_10117421
205 Ga0307513_10386355
206 Ga0307508_10002359
207 Ga0307508_10145100
208 Ga0316575_10024919
209 Ga0265314_10000003
210 Ga0265314_10012277
211 Ga0316576_10040623
212 Ga0316576_10051016
213 Ga0316576_10064472
214 Ga0316578_10021223
215 Ga0307516_10003525
216 Ga0316577_10072982
217 Ga0307406_10020314
218 Ga0307412_10080594
219 Ga0307507_10068318
220 Ga0373936_0062124
221 Ga0316574_0072205
222 Ga0373927_0022903
223 Ga0373933_0063274
224 Ga0373925_0134194
225 Ga0400489_15688
226 Ga0436365_0420179
227 Ga0439465_0051970
228 Ga0451793_1647706
229 Ga0451797_1363255
230 Ga0451802_0589169
231 Ga0451807_0121406
232 Ga0451841_1402568
233 Ga0451849_1075358
234 Ga0451853_4023065
235 Ga0439445_0049243
236 Ga0439458_0014694
237 Ga0451577_0085742
238 Ga0451577_0395224
239 Ga0466970_0440641
240 Ga0451576_0447400
241 Ga0466967_0067795
242 Ga0495660_0199876
243 Ga0496121_0277906
244 Ga0501034_0104920
245 Ga0501047_0094030
246 Ga0501067_0009529
247 Ga0501067_0044582
248 Ga0501068_0056958
249 Ga0501073_0018169
250 Ga0501073_0249119
251 Ga0501074_0015591
252 Ga0501253_006948
253 Ga0501083_0025176
254 Ga0501083_0251389
255 nmdc:mga0k408_10491_c1
256 nmdc:mga0k408_57856_c1
257 nmdc:mga0k408_96851_c1
258 nmdc:mga09592_611419_c1
259 nmdc:mga08y16_88201_c1
260 Ga0500635_0031308
261 Ga0500588_0008387
262 Ga0501084_0002285
263 Ga0501084_0459723
264 Ga0501082_0012521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

72

283

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.959 27 266
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.949 15 268
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9456 16 265
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.9451 15 268
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.9429 16 265
ID Description Score Start End Superfamily
af_Q4CW08_15_171_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4352 73 261 1.10.1760.20
af_Q84K71_316_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4342 73 264 1.20.1250.20
af_Q4CW08_15_171_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4233 73 261 1.10.1760.20
af_Q84K71_316_482_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4152 73 264 1.20.1250.20
af_A0A0R0G8C6_282_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3883 31 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V6UUM2-F1-model_v4 ABC transporter permease 0.9865 50 264 GO:0005548
GO:0043190
AF-A0A7V3ST55-F1-model_v4 ABC transporter permease 0.9844 72 266 GO:0005548
GO:0043190
AF-A0A3N5MPF7-F1-model_v4 ABC transporter permease 0.9838 83 267 GO:0005548
GO:0043190
AF-A0A7Y2KHH7-F1-model_v4 ABC transporter permease 0.9829 16 267 GO:0005548
GO:0043190
AF-A0A836T0P6-F1-model_v4 ABC transporter permease 0.9828 21 267 GO:0005548
GO:0043190

Map