F152020

General Info

Members Datasets Scaffolds Average Seq Length
132 93 108 174

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100002423|Ga0070698_1000024232
Length 198
Sequence MPWHRACHRCCCRILPRLTRPGFEKRTGVATVASINDLFHAAAQSAAHMEMRESYMPADPDWLAWQAGQKFDPAERWREWFDLVAAAVARGVAVRRARIVSEPVSDYVRFEHEVTPGINLAAGEQVRWLPRRRALDLMVPVCDFWLIDNRLLAWNHFAGDGSWVAMETSDDPRLAKLYGSAFEAVWERATPHADYRPP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
3 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
4 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
5 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
6 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
7 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
8 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
9 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
10 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
11 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
12 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
13 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
25 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
44 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
52 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
53 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
54 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
55 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
58 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
61 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
62 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
63 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
64 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
65 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
66 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
67 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
87 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
88 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
89 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
90 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
91 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
92 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
93 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.55
Metatranscriptomes 2.27
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0
Rhizoplane 0
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 23.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10008201 3300003320 Bacteria 16479
2 Ga0070713_100056496 3300005436 Bacteria 3265
3 Ga0070685_10553822 3300005466 Unclassified 821
4 Ga0070706_100007039 3300005467 Bacteria 10606
5 Ga0070698_100002423 3300005471 Bacteria 20548
6 Ga0075428_100792704 3300006844 Bacteria 1007
7 Ga0114129_11625054 3300009147 Bacteria 790
8 Ga0105238_10304354 3300009551 Bacteria 1578
9 Ga0105239_11017817 3300010375 Bacteria 953
10 Ga0182008_10003742 3300014497 Bacteria 9062
11 Ga0206355_1228299 3300020076 Bacteria 1047
12 Ga0224712_10093895 3300022467 Bacteria 1261
13 Ga0224712_10122616 3300022467 Bacteria 1127
14 Ga0209758_1009426 3300025297 Bacteria 6071
15 Ga0207426_1103052 3300025302 Bacteria 733
16 Ga0207684_10016017 3300025910 Bacteria 6438
17 Ga0207693_10449493 3300025915 Bacteria 1007
18 Ga0207700_10043938 3300025928 Bacteria 3286
19 Ga0207700_10304934 3300025928 Bacteria 1376
20 Ga0307517_10046138 3300028786 Bacteria 4558
21 Ga0265338_10236954 3300028800 Unclassified 1354
22 Ga0307512_10002176 3300030522 Bacteria 25595
23 Ga0307513_10016759 3300031456 Bacteria 8816
24 Ga0307509_10014877 3300031507 Bacteria 9118
25 Ga0307509_10029927 3300031507 Bacteria 6031
26 Ga0307508_10039715 3300031616 Bacteria 4226
27 Ga0307516_10037961 3300031730 Bacteria 4811
28 Ga0307518_10009930 3300031838 Bacteria 6791
29 Ga0307518_10029569 3300031838 Bacteria 3966
30 Ga0307507_10029694 3300033179 Bacteria 5789
31 Ga0316214_1029310 3300033545 Unclassified 780
32 Ga0395898_0001558 3300037466 Bacteria 31442
33 Ga0395898_0118848 3300037466 Bacteria 2532
34 Ga0395901_0917003 3300038443 Bacteria 857
35 Ga0451835_0736184 3300041492 Bacteria 602
36 Ga0451843_0881080 3300041509 Bacteria 895
37 Ga0451853_0121887 3300041512 Bacteria 5929
38 Ga0451853_0919386 3300041512 Bacteria 1146
39 Ga0451853_2674602 3300041512 Bacteria 1838
40 Ga0451853_3366836 3300041512 Bacteria 1813
41 Ga0466969_0000195 3300044656 Bacteria 32686
42 Ga0466958_0257731 3300045836 Unclassified 1116
43 Ga0466967_0115118 3300045976 Bacteria 2476
44 Ga0495629_0024109 3300046459 Bacteria 4333
45 Ga0495651_0000508 3300046462 Bacteria 30213
46 Ga0495651_0173017 3300046462 Bacteria 1536
47 Ga0495618_0074294 3300046514 Bacteria 2165
48 Ga0495642_0011100 3300046528 Bacteria 3455
49 Ga0495652_0206102 3300046529 Bacteria 1489
50 Ga0495587_0003959 3300046536 Bacteria 9825
51 Ga0495587_0093741 3300046536 Bacteria 1734
52 Ga0495622_0000141 3300046557 Bacteria 62170
53 Ga0495622_0024199 3300046557 Bacteria 2836
54 Ga0495622_0035689 3300046557 Bacteria 2318
55 Ga0495622_0100474 3300046557 Bacteria 1326
56 Ga0495622_0409426 3300046557 Bacteria 583
57 Ga0495667_0038896 3300046559 Bacteria 3167
58 Ga0495634_0000312 3300046642 Bacteria 46634
59 Ga0495625_0006687 3300046660 Bacteria 10226
60 Ga0495635_0008440 3300046663 Bacteria 7194
61 Ga0495588_0013816 3300046674 Bacteria 3853
62 Ga0495588_0374812 3300046674 Bacteria 747
63 Ga0495657_0002570 3300046675 Bacteria 15215
64 Ga0495600_0000949 3300046809 Bacteria 15569
65 Ga0495600_0002796 3300046809 Bacteria 10134
66 Ga0495604_0000319 3300047317 Bacteria 43297
67 Ga0495604_0078207 3300047317 Bacteria 2483
68 Ga0495604_0400055 3300047317 Bacteria 905
69 Ga0495636_0137000 3300047318 Bacteria 1091
70 Ga0495675_0116213 3300047444 Bacteria 1668
71 Ga0495685_000363 3300047447 Bacteria 14422
72 Ga0495685_003277 3300047447 Bacteria 5156
73 Ga0495681_0044133 3300047470 Bacteria 2145
74 Ga0495602_0124488 3300048088 Bacteria 2068
75 Ga0495602_0277960 3300048088 Bacteria 1235
76 Ga0495614_0060621 3300048089 Bacteria 1626
77 Ga0501032_0171007 3300049569 Bacteria 1425
78 Ga0501033_0020584 3300049570 Bacteria 4985
79 Ga0501033_0030140 3300049570 Bacteria 4076
80 Ga0501037_0157736 3300049573 Bacteria 1619
81 Ga0501038_0979918 3300049574 Bacteria 621
82 Ga0501039_0055911 3300049575 Bacteria 3057
83 Ga0501042_0104029 3300049578 Bacteria 2043
84 Ga0501043_0224500 3300049579 Bacteria 1452
85 Ga0501043_0932799 3300049579 Unclassified 621
86 Ga0501046_0000367 3300049580 Bacteria 45511
87 Ga0501046_0204360 3300049580 Bacteria 1469
88 Ga0501046_0769867 3300049580 Bacteria 675
89 Ga0501047_0000189 3300049581 Bacteria 74827
90 Ga0501047_0023618 3300049581 Bacteria 5902
91 Ga0501047_0766881 3300049581 Bacteria 780
92 Ga0501047_1032248 3300049581 Bacteria 635
93 Ga0501048_0872713 3300049582 Bacteria 647
94 Ga0501080_0781252 3300049742 Bacteria 838
95 Ga0501035_0074476 3300049822 Bacteria 3003
96 Ga0501035_0321845 3300049822 Bacteria 1299
97 Ga0501044_0102781 3300049823 Bacteria 2873
98 Ga0501044_0381027 3300049823 Bacteria 1325
99 Ga0501044_0540366 3300049823 Bacteria 1063
100 Ga0501044_0994872 3300049823 Bacteria 711
101 Ga0501044_1019480 3300049823 Bacteria 699
102 Ga0501045_0441786 3300049824 Bacteria 967
103 nmdc:mga05p37_1518615_c1 3300050507 Bacteria 666
104 nmdc:mga05p37_492283_c1 3300050507 Unclassified 1409
105 nmdc:mga06r32_27286_c1 3300050510 Bacteria 5332
106 Ga0500640_135127 3300053095 Bacteria 966
107 Ga0500573_0100199 3300053140 Bacteria 1631
108 Ga0500573_0147858 3300053140 Bacteria 1289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0000141 Ga0495622_0000141_36618_37142 142
2 3300053140 Ga0500573_0100199 Ga0500573_0100199_206_736 145
3 3300046660 Ga0495625_0006687 Ga0495625_0006687_7930_8454 146
4 3300049580 Ga0501046_0769867 Ga0501046_0769867_71_580 151
5 3300049823 Ga0501044_0994872 Ga0501044_0994872_150_659 151
6 iso_pu_bacteria 3006321560 3006327572 151
7 3300030522 Ga0307512_10002176 Ga0307512_100021764 152
8 3300031616 Ga0307508_10039715 Ga0307508_100397153 152
9 3300046557 Ga0495622_0409426 Ga0495622_0409426_64_522 152
10 3300049578 Ga0501042_0104029 Ga0501042_0104029_176_736 152
11 3300049580 Ga0501046_0204360 Ga0501046_0204360_534_1046 152
12 3300049581 Ga0501047_0000189 Ga0501047_0000189_38687_39247 152
13 3300049581 Ga0501047_1032248 Ga0501047_1032248_36_548 152
14 3300049582 Ga0501048_0872713 Ga0501048_0872713_19_531 152
15 3300049742 Ga0501080_0781252 Ga0501080_0781252_150_662 152
16 3300049822 Ga0501035_0321845 Ga0501035_0321845_167_727 152
17 3300049823 Ga0501044_0102781 Ga0501044_0102781_1002_1562 152
18 3300049823 Ga0501044_0381027 Ga0501044_0381027_328_840 152
19 iso_pu_bacteria 2873314349 2873317591 152
20 3300005436 Ga0070713_100056496 Ga0070713_1000564964 153
21 3300005467 Ga0070706_100007039 Ga0070706_1000070399 153
22 3300005471 Ga0070698_100002423 Ga0070698_1000024232 153
23 3300006844 Ga0075428_100792704 Ga0075428_1007927042 153
24 3300009147 Ga0114129_11625054 Ga0114129_116250542 153
25 3300022467 Ga0224712_10122616 Ga0224712_101226161 153
26 3300025910 Ga0207684_10016017 Ga0207684_100160175 153
27 3300025915 Ga0207693_10449493 Ga0207693_104494932 153
28 3300025928 Ga0207700_10043938 Ga0207700_100439383 153
29 3300033545 Ga0316214_1029310 Ga0316214_10293101 153
30 3300045836 Ga0466958_0257731 Ga0466958_0257731_94_603 153
31 3300046462 Ga0495651_0173017 Ga0495651_0173017_91_603 153
32 3300048088 Ga0495602_0124488 Ga0495602_0124488_377_889 153
33 3300049579 Ga0501043_0932799 Ga0501043_0932799_43_552 153
34 3300050507 nmdc:mga05p37_1518615_c1 nmdc:mga05p37_1518615_c1_24_539 153
35 3300050507 nmdc:mga05p37_492283_c1 nmdc:mga05p37_492283_c1_771_1286 153
36 3300050510 nmdc:mga06r32_27286_c1 nmdc:mga06r32_27286_c1_2824_3339 153
37 3300053140 Ga0500573_0147858 Ga0500573_0147858_577_1089 153
38 iso_pu_bacteria 2995463766 2995466378 153
39 3300025928 Ga0207700_10304934 Ga0207700_103049342 154
40 3300046557 Ga0495622_0035689 Ga0495622_0035689_1323_1832 154
41 3300046674 Ga0495588_0374812 Ga0495588_0374812_31_540 154
42 iso_pu_bacteria 8055066027 8055068919 154
43 3300020076 Ga0206355_1228299 Ga0206355_12282992 156
44 3300022467 Ga0224712_10093895 Ga0224712_100938952 156
45 3300028800 Ga0265338_10236954 Ga0265338_102369542 156
46 3300031507 Ga0307509_10029927 Ga0307509_100299276 156
47 3300031730 Ga0307516_10037961 Ga0307516_100379612 156
48 3300031838 Ga0307518_10009930 Ga0307518_100099307 156
49 3300041512 Ga0451853_0121887 Ga0451853_0121887_2176_2700 156
50 3300046462 Ga0495651_0000508 Ga0495651_0000508_12429_12962 156
51 3300046559 Ga0495667_0038896 Ga0495667_0038896_1783_2316 156
52 3300047317 Ga0495604_0078207 Ga0495604_0078207_24_557 156
53 3300047444 Ga0495675_0116213 Ga0495675_0116213_551_1084 156
54 3300049581 Ga0501047_0766881 Ga0501047_0766881_209_736 156
55 iso_pu_bacteria 2784132148 2784592897 156
56 iso_pu_bacteria 2887478801 2887482707 156
57 3300009551 Ga0105238_10304354 Ga0105238_103043542 157
58 3300010375 Ga0105239_11017817 Ga0105239_110178171 157
59 3300031456 Ga0307513_10016759 Ga0307513_100167593 157
60 3300041512 Ga0451853_2674602 Ga0451853_2674602_680_1207 157
61 3300046528 Ga0495642_0011100 Ga0495642_0011100_2729_3253 157
62 3300046557 Ga0495622_0100474 Ga0495622_0100474_204_728 157
63 3300047470 Ga0495681_0044133 Ga0495681_0044133_1303_1827 157
64 iso_pu_bacteria 2784746763 2785343923 157
65 iso_pu_bacteria 2818991472 2819739693 157
66 iso_pu_bacteria 2818991472 2819746694 157
67 iso_pu_bacteria 2997600082 2997601604 157
68 iso_pu_bacteria 8048127548 8048134883 157
69 iso_pu_bacteria 8056060235 8056062173 157
70 iso_pu_bacteria 8056447290 8056454068 157
71 iso_pu_bacteria 8056667051 8056671925 157
72 3300005466 Ga0070685_10553822 Ga0070685_105538222 158
73 3300014497 Ga0182008_10003742 Ga0182008_100037422 158
74 3300025297 Ga0209758_1009426 Ga0209758_10094266 158
75 3300025302 Ga0207426_1103052 Ga0207426_11030522 158
76 3300028786 Ga0307517_10046138 Ga0307517_100461383 158
77 3300031507 Ga0307509_10014877 Ga0307509_100148773 158
78 3300037466 Ga0395898_0001558 Ga0395898_0001558_25102_25629 158
79 3300038443 Ga0395901_0917003 Ga0395901_0917003_135_662 158
80 3300041492 Ga0451835_0736184 Ga0451835_0736184_22_549 158
81 3300041509 Ga0451843_0881080 Ga0451843_0881080_143_670 158
82 3300041512 Ga0451853_0919386 Ga0451853_0919386_127_654 158
83 3300044656 Ga0466969_0000195 Ga0466969_0000195_27262_27792 158
84 3300045976 Ga0466967_0115118 Ga0466967_0115118_896_1423 158
85 3300046536 Ga0495587_0093741 Ga0495587_0093741_358_885 158
86 3300046557 Ga0495622_0024199 Ga0495622_0024199_1378_1905 158
87 3300046809 Ga0495600_0002796 Ga0495600_0002796_4111_4638 158
88 3300047317 Ga0495604_0400055 Ga0495604_0400055_285_812 158
89 3300049569 Ga0501032_0171007 Ga0501032_0171007_306_833 158
90 3300049570 Ga0501033_0020584 Ga0501033_0020584_4426_4953 158
91 3300049570 Ga0501033_0030140 Ga0501033_0030140_830_1360 158
92 3300049573 Ga0501037_0157736 Ga0501037_0157736_854_1381 158
93 3300049574 Ga0501038_0979918 Ga0501038_0979918_63_590 158
94 3300049575 Ga0501039_0055911 Ga0501039_0055911_974_1501 158
95 3300049579 Ga0501043_0224500 Ga0501043_0224500_36_563 158
96 3300049580 Ga0501046_0000367 Ga0501046_0000367_41853_42380 158
97 3300049581 Ga0501047_0023618 Ga0501047_0023618_4351_4878 158
98 3300049822 Ga0501035_0074476 Ga0501035_0074476_231_758 158
99 3300049823 Ga0501044_0540366 Ga0501044_0540366_306_833 158
100 3300049823 Ga0501044_1019480 Ga0501044_1019480_37_564 158
101 3300049824 Ga0501045_0441786 Ga0501045_0441786_105_632 158
102 iso_pu_bacteria 2558860112 2558907552 158
103 iso_pu_bacteria 2558860112 2558910882 158
104 iso_pu_bacteria 2818991472 2819741497 158
105 iso_pu_bacteria 2954701450 2954705620 158
106 iso_pu_bacteria 2990059506 2990062498 158
107 3300047447 Ga0495685_003277 Ga0495685_003277_2042_2572 159
108 iso_pu_bacteria 2818991472 2819747065 159
109 iso_pu_bacteria 2990059506 2990060370 159
110 iso_pu_bacteria 8025530807 8025531313 159
111 3300003320 rootH2_10008201 rootH2_1000820120 160
112 3300031838 Ga0307518_10029569 Ga0307518_100295694 160
113 3300033179 Ga0307507_10029694 Ga0307507_100296944 160
114 3300037466 Ga0395898_0118848 Ga0395898_0118848_977_1510 160
115 3300041512 Ga0451853_3366836 Ga0451853_3366836_684_1220 160
116 3300046459 Ga0495629_0024109 Ga0495629_0024109_1507_2040 160
117 3300046514 Ga0495618_0074294 Ga0495618_0074294_1458_1991 160
118 3300046529 Ga0495652_0206102 Ga0495652_0206102_568_1101 160
119 3300046536 Ga0495587_0003959 Ga0495587_0003959_605_1138 160
120 3300046642 Ga0495634_0000312 Ga0495634_0000312_26722_27255 160
121 3300046663 Ga0495635_0008440 Ga0495635_0008440_4594_5127 160
122 3300046674 Ga0495588_0013816 Ga0495588_0013816_1854_2387 160
123 3300046675 Ga0495657_0002570 Ga0495657_0002570_1574_2107 160
124 3300046809 Ga0495600_0000949 Ga0495600_0000949_9882_10415 160
125 3300047317 Ga0495604_0000319 Ga0495604_0000319_15223_15756 160
126 3300047318 Ga0495636_0137000 Ga0495636_0137000_247_780 160
127 3300047447 Ga0495685_000363 Ga0495685_000363_1091_1624 160
128 3300048088 Ga0495602_0277960 Ga0495602_0277960_230_763 160
129 3300048089 Ga0495614_0060621 Ga0495614_0060621_498_1031 160
130 3300053095 Ga0500640_135127 Ga0500640_135127_262_795 160
131 iso_pu_bacteria 2808606359 2808841561 160
132 iso_pu_bacteria 2946072368 2946075471 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21806

DUF6879

Family of unknown function (DUF6879)

33

197

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ut0-assembly1.cif.gz_A crystal structure of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. bb1 0.7322 39 61
3ngl-assembly1.cif.gz_C crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from thermoplasma acidophilum 0.6924 39 90
3ut0-assembly3.cif.gz_C crystal structure of exo-1,3/1,4-beta-glucanase (exop) from pseudoalteromonas sp. bb1 0.6835 41 61
6s4f-assembly1.cif.gz_B structure of human mthfd2 in complex with th9619 0.6563 40 91
3ez4-assembly1.cif.gz_G crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.646 42 88
ID Description Score Start End Superfamily
af_Q86KU6_18_143_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7543 35 90 3.40.50.10860
af_A4HZR2_37_186_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7348 39 90 3.40.50.10860
af_Q54RI8_12_107_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7344 39 90 3.40.50.10860
af_Q4CYS6_190_494_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7298 38 61 3.40.50.300
af_P39280_51_334_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6813 41 89 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W8BDS0-F1-model_v4 DUF6879 domain-containing protein 0.9902 30 158
AF-A0A1C4MUY6-F1-model_v4 deleted 0.9875 56 160
AF-A0A445NC04-F1-model_v4 deleted 0.9867 2 156
AF-L1L1W7-F1-model_v4 DUF6879 domain-containing protein 0.9854 2 158
AF-A0A429RH76-F1-model_v4 DUF6879 domain-containing protein 0.9852 2 160

Feature Viewer

pLDDT pTM Quality
93.87 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map