F150323

General Info

Members Datasets Scaffolds Average Seq Length
131 111 263 122

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0006212|Ga0495606_0006212_9647_10000
Length 117
Sequence MMTGGEIFREAWIAGVRKHFPGEPKPSYVTPWDDTPAWEQASAGAVYEQVALLIRQGGTDKLSREQKGRFVALCWIAQIYRHIPDPKPAYVADWELLPEWQQETDADIFEHVASSMA

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
42 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
53 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
56 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
57 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
58 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
59 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
60 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
61 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
62 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
78 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
81 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
84 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
85 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
86 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
87 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
88 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
89 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
90 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
91 2547132424 Nocardia nova SH22a Isolate Unclassified
92 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
93 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
94 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
95 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
96 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
97 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
98 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
99 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
100 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
101 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
102 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
103 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
104 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
105 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
106 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
107 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
108 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
109 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
110 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
111 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.1
Metatranscriptomes 3.05
Isolates 19.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 0
Rhizoplane 1.53
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 6.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0006212 3300046507 Bacteria 11104
2 rootH1_10001992 3300003316 Bacteria 12746
3 rootH2_10104221 3300003320 Bacteria 13348
4 rootL2_10051654 3300003322 Bacteria 5932
5 rootH1_10007856 3300003316 Bacteria 4332
6 rootH1_10007856 3300003323 Bacteria 7740
7 Ga0070714_100017640 3300005435 Bacteria 5786
8 Ga0070713_100187534 3300005436 Bacteria 1862
9 Ga0070710_10070860 3300005437 Bacteria 2009
10 Ga0070711_100050148 3300005439 Bacteria 2861
11 Ga0070706_100311196 3300005467 Bacteria 1469
12 Ga0070712_100607439 3300006175 Bacteria 926
13 Ga0075428_100174561 3300006844 Bacteria 2328
14 Ga0105240_10910942 3300009093 Bacteria 945
15 Ga0105240_11094705 3300009093 Unclassified 848
16 Ga0105237_10220642 3300009545 Bacteria 1896
17 Ga0105238_10545091 3300009551 Bacteria 1164
18 Ga0105239_10257960 3300010375 Bacteria 1959
19 Ga0157374_10112401 3300013296 Unclassified 2621
20 Ga0182008_10004705 3300014497 Bacteria 7919
21 Ga0197907_11246402 3300020069 Unclassified 979
22 Ga0206356_11660648 3300020070 Unclassified 751
23 Ga0206355_1378346 3300020076 Unclassified 654
24 Ga0213875_10266546 3300021388 Unclassified 808
25 Ga0224712_10049545 3300022467 Unclassified 1627
26 Ga0207692_10049398 3300025898 Bacteria 2123
27 Ga0207671_10139001 3300025914 Bacteria 1870
28 Ga0207671_10715600 3300025914 Bacteria 796
29 Ga0207693_10325053 3300025915 Bacteria 1204
30 Ga0207663_10036679 3300025916 Bacteria 2951
31 Ga0207657_11264454 3300025919 Bacteria 559
32 Ga0207694_10365292 3300025924 Bacteria 1196
33 Ga0207700_10077196 3300025928 Bacteria 2587
34 Ga0207664_10026197 3300025929 Bacteria 4404
35 Ga0307511_10001274 3300030521 Bacteria 26705
36 Ga0307513_10010707 3300031456 Bacteria 11472
37 Ga0307513_10063999 3300031456 Bacteria 3879
38 Ga0307513_10273230 3300031456 Bacteria 1472
39 Ga0307508_10007760 3300031616 Bacteria 9970
40 Ga0307514_10035503 3300031649 Bacteria 3968
41 Ga0307516_10578439 3300031730 Bacteria 777
42 Ga0307413_10091697 3300031824 Bacteria 1981
43 Ga0373937_0063337 3300036401 Bacteria 3401
44 Ga0395898_1364210 3300037466 Bacteria 637
45 Ga0436364_0406081 3300037853 Bacteria 7167
46 Ga0436364_1481566 3300037853 Bacteria 8342
47 Ga0436365_0096517 3300039437 Unclassified 726
48 Ga0436362_1132237 3300039453 Bacteria 23509
49 Ga0451853_1768014 3300041512 Bacteria 6226
50 Ga0466972_0005633 3300044658 Bacteria 6279
51 Ga0466965_0032511 3300044683 Bacteria 2548
52 Ga0466966_0020553 3300044684 Bacteria 4339
53 Ga0466961_0025295 3300044693 Bacteria 3818
54 Ga0466961_0057027 3300044693 Bacteria 2488
55 Ga0466971_0060986 3300044719 Bacteria 1705
56 Ga0466968_0091904 3300044735 Bacteria 1346
57 Ga0466959_0263139 3300045049 Bacteria 1187
58 Ga0466967_0426721 3300045976 Bacteria 1293
59 Ga0495594_0032021 3300046499 Bacteria 2852
60 Ga0495583_0155211 3300046506 Bacteria 947
61 Ga0495666_0000007 3300046526 Bacteria 106518
62 Ga0495622_0077507 3300046557 Bacteria 1531
63 Ga0495668_0000395 3300046616 Bacteria 57512
64 Ga0495625_0001063 3300046660 Bacteria 35918
65 Ga0495588_0050164 3300046674 Bacteria 2147
66 Ga0495660_0036063 3300046810 Bacteria 2759
67 Ga0495676_0053602 3300047321 Bacteria 3213
68 Ga0495683_0144335 3300047323 Bacteria 1113
69 Ga0495626_0000107 3300048091 Bacteria 109694
70 Ga0496112_0084218 3300048915 Bacteria 3145
71 Ga0501031_0027213 3300049568 Bacteria 3729
72 Ga0501031_0910298 3300049568 Bacteria 563
73 Ga0501032_0035808 3300049569 Bacteria 3391
74 Ga0501032_0556531 3300049569 Bacteria 731
75 Ga0501033_0031973 3300049570 Bacteria 3950
76 Ga0501033_0090937 3300049570 Bacteria 2232
77 Ga0501034_0042289 3300049571 Bacteria 4613
78 Ga0501034_1455432 3300049571 Bacteria 559
79 Ga0501036_0047123 3300049572 Bacteria 3650
80 Ga0501036_0580640 3300049572 Bacteria 930
81 Ga0501039_0033919 3300049575 Bacteria 3938
82 Ga0501040_0452969 3300049576 Bacteria 924
83 Ga0501043_0029336 3300049579 Bacteria 4321
84 Ga0501043_0054936 3300049579 Bacteria 3128
85 Ga0501043_0100641 3300049579 Bacteria 2272
86 Ga0501047_0035708 3300049581 Bacteria 4802
87 Ga0501047_0183665 3300049581 Bacteria 1957
88 Ga0501047_0203070 3300049581 Bacteria 1842
89 Ga0501070_0014490 3300049586 Bacteria 6635
90 Ga0501035_0007159 3300049822 Bacteria 10436
91 Ga0501035_0028524 3300049822 Bacteria 5094
92 Ga0501035_0160694 3300049822 Bacteria 1944
93 Ga0501044_0008887 3300049823 Bacteria 10982
94 Ga0501044_0063525 3300049823 Bacteria 3771
95 Ga0501045_0404526 3300049824 Bacteria 1016
96 nmdc:mga0yw44_287777_c1 3300050492 Bacteria 1099
97 nmdc:mga0qj67_5397_c1 3300050509 Bacteria 9332
98 nmdc:mga06r32_189211_c1 3300050510 Bacteria 2046
99 Ga0495601_0016601 3300053077 Bacteria 4463
100 Ga0495612_0016361 3300053078 Bacteria 2973
101 Ga0495619_0062387 3300053085 Bacteria 2481
102 Ga0500644_0126865 3300053088 Bacteria 1000
103 Ga0500646_0000033 3300053090 Bacteria 40024
104 Ga0500646_0000155 3300053090 Bacteria 20110
105 Ga0500634_0235278 3300053161 Bacteria 774
106 Ga0466962_0076937 3300061719 Bacteria 1595
107 2515496248 2515154088 Bacteria 5526283
108 2515723042 2515154129 Bacteria 5584369
109 2515759130 2515154137 Bacteria 5711575
110 2516086731 2515154202 Bacteria 5471270
111 2516087254 2515154202 Bacteria 5471270
112 2548693927 2547132424 Bacteria 8348532
113 2616899613 2616644941 Bacteria 8510691
114 2760623085 2758568621 Bacteria 5967089
115 2768644889 2767802112 Bacteria 6465194
116 2795792998 2795385472 Bacteria 6627535
117 2862711202 2862705112 Bacteria 6563286
118 2867352684 2867346516 Bacteria 7608576
119 2875395341 2875391855 Bacteria 7600475
120 2891972487 2891968417 Bacteria 5821697
121 2899368892 2899359706 Bacteria 10940472
122 2990047715 2990044586 Bacteria 6603797
123 8008489634 8008485437 Bacteria 7198341
124 8025417130 8025413630 Bacteria 7014048
125 8025528790 8025524527 Bacteria 7197316
126 8025533179 8025530807 Bacteria 8495698
127 8033687500 8033684223 Bacteria 6906479
128 8047896933 8047893842 Bacteria 11723082
129 8048373918 8048369669 Bacteria 11666822
130 8048384309 8048379754 Bacteria 11877923
131 8053951652 8053945823 Bacteria 8962862
132 8054166850 8054160619 Bacteria 7783213
133 Ga0495606_0006212
134 rootH1_10001992
135 rootH2_10104221
136 rootL2_10051654
137 rootH1_10007856
138 Ga0070714_100017640
139 Ga0070713_100187534
140 Ga0070710_10070860
141 Ga0070711_100050148
142 Ga0070706_100311196
143 Ga0070712_100607439
144 Ga0075428_100174561
145 Ga0105240_10910942
146 Ga0105240_11094705
147 Ga0105237_10220642
148 Ga0105238_10545091
149 Ga0105239_10257960
150 Ga0157374_10112401
151 Ga0182008_10004705
152 Ga0197907_11246402
153 Ga0206356_11660648
154 Ga0206355_1378346
155 Ga0213875_10266546
156 Ga0224712_10049545
157 Ga0207692_10049398
158 Ga0207671_10139001
159 Ga0207671_10715600
160 Ga0207693_10325053
161 Ga0207663_10036679
162 Ga0207657_11264454
163 Ga0207694_10365292
164 Ga0207700_10077196
165 Ga0207664_10026197
166 Ga0307511_10001274
167 Ga0307513_10010707
168 Ga0307513_10063999
169 Ga0307513_10273230
170 Ga0307508_10007760
171 Ga0307514_10035503
172 Ga0307516_10578439
173 Ga0307413_10091697
174 Ga0373937_0063337
175 Ga0395898_1364210
176 Ga0436364_0406081
177 Ga0436364_1481566
178 Ga0436365_0096517
179 Ga0436362_1132237
180 Ga0451853_1768014
181 Ga0466972_0005633
182 Ga0466965_0032511
183 Ga0466966_0020553
184 Ga0466961_0025295
185 Ga0466961_0057027
186 Ga0466971_0060986
187 Ga0466968_0091904
188 Ga0466959_0263139
189 Ga0466967_0426721
190 Ga0495594_0032021
191 Ga0495583_0155211
192 Ga0495666_0000007
193 Ga0495622_0077507
194 Ga0495668_0000395
195 Ga0495625_0001063
196 Ga0495588_0050164
197 Ga0495660_0036063
198 Ga0495676_0053602
199 Ga0495683_0144335
200 Ga0495626_0000107
201 Ga0496112_0084218
202 Ga0501031_0027213
203 Ga0501031_0910298
204 Ga0501032_0035808
205 Ga0501032_0556531
206 Ga0501033_0031973
207 Ga0501033_0090937
208 Ga0501034_0042289
209 Ga0501034_1455432
210 Ga0501036_0047123
211 Ga0501036_0580640
212 Ga0501039_0033919
213 Ga0501040_0452969
214 Ga0501043_0029336
215 Ga0501043_0054936
216 Ga0501043_0100641
217 Ga0501047_0035708
218 Ga0501047_0183665
219 Ga0501047_0203070
220 Ga0501070_0014490
221 Ga0501035_0007159
222 Ga0501035_0028524
223 Ga0501035_0160694
224 Ga0501044_0008887
225 Ga0501044_0063525
226 Ga0501045_0404526
227 nmdc:mga0yw44_287777_c1
228 nmdc:mga0qj67_5397_c1
229 nmdc:mga06r32_189211_c1
230 Ga0495601_0016601
231 Ga0495612_0016361
232 Ga0495619_0062387
233 Ga0500644_0126865
234 Ga0500646_0000033
235 Ga0500646_0000155
236 Ga0500634_0235278
237 Ga0466962_0076937
238 2515496248
239 2515723042
240 2515759130
241 2516086731
242 2516087254
243 2548693927
244 2616899613
245 2760623085
246 2768644889
247 2795792998
248 2862711202
249 2867352684
250 2875395341
251 2891972487
252 2899368892
253 2990047715
254 8008489634
255 8025417130
256 8025528790
257 8025533179
258 8033687500
259 8047896933
260 8048373918
261 8048384309
262 8053951652
263 8054166850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ard-assembly1.cif.gz_Y cryo-em structure of polytomella complex-i (complete composition) 0.3846 3 99
6e10-assembly1.cif.gz_A ptex core complex in the engaged (extended) state 0.3846 2 97
7m5c-assembly3.cif.gz_E crystal structure of human bak in complex with wt bak bh3 peptide 0.3354 6 118
6y79-assembly1.cif.gz_J cryo-em structure of a respiratory complex i f89a mutant 0.3292 5 114
7ard-assembly1.cif.gz_Y cryo-em structure of polytomella complex-i (complete composition) 0.3277 3 99
ID Description Score Start End Superfamily
1t6pD03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.4779 10 118 1.10.274.20
af_A0A0R0F7P8_38_136_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4287 6 95 1.10.10.1740
af_P0AD14_27_197_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4136 7 92 1.10.1760.20
1t6pD03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.4111 10 118 1.10.274.20
af_P95210_10_113_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4073 6 118 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A1Q4YMR3-F1-model_v4 Uncharacterized protein 1.004 6 118
AF-A0A542PAK9-F1-model_v4 deleted 1.003 6 118
AF-A0A327V5K8-F1-model_v4 Uncharacterized protein 1.002 19 119
AF-L8PJ25-F1-model_v4 Uncharacterized protein 1.001 49 118
AF-A0A5N6AIR9-F1-model_v4 Uncharacterized protein 0.9995 4 116

Map