F150295

General Info

Members Datasets Scaffolds Average Seq Length
131 115 262 117

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0042509|Ga0495639_0042509_1528_1920
Length 130
Sequence LPRTGPEVQLEKQFSFEAAHRLPRVPDGHKCGRLHGHSFRLDVRVRGPVDPVSGWYIDYAEIGSAVRTRVLERLDHYFLNEVPGLENPTSENLAVWIWKELSDVLPGLHEIVVYETCTARCVYRGEPSHG

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
93 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
94 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
98 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
99 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
100 2738543023 Pedobacter sp. OK628 Isolate Unclassified
101 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
102 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
103 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
104 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
105 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
106 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
107 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
108 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
109 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
110 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
111 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
112 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
113 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
114 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
115 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.26
Metatranscriptomes 0
Isolates 13.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.53
Rhizoplane 2.29
Rhizosphere 85.5
Stem 0
Stem Tuber 3.05
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0042509 3300046475 Bacteria 2050
2 Ga0058692_1000019 3300003856 Bacteria 255580
3 Ga0065714_10271034 3300005288 Bacteria 734
4 Ga0065714_10299731 3300005288 Bacteria 690
5 Ga0065704_10126253 3300005289 Bacteria 1670
6 Ga0065707_10339591 3300005295 Bacteria 936
7 Ga0070658_10936459 3300005327 Bacteria 753
8 Ga0070690_100006509 3300005330 Bacteria 6626
9 Ga0070689_100889701 3300005340 Bacteria 787
10 Ga0070687_100263138 3300005343 Bacteria 1077
11 Ga0070668_100306673 3300005347 Bacteria 1333
12 Ga0070671_100330363 3300005355 Bacteria 1300
13 Ga0070674_100346515 3300005356 Bacteria 1198
14 Ga0070673_100418537 3300005364 Bacteria 1201
15 Ga0070688_100955922 3300005365 Bacteria 678
16 Ga0070659_101529620 3300005366 Bacteria 595
17 Ga0070667_100183056 3300005367 Bacteria 1853
18 Ga0070709_10000057 3300005434 Bacteria 87352
19 Ga0070705_101088968 3300005440 Bacteria 653
20 Ga0070694_100008684 3300005444 Bacteria 6222
21 Ga0070662_100652093 3300005457 Bacteria 888
22 Ga0068867_100019857 3300005459 Bacteria 4789
23 Ga0070707_100134698 3300005468 Bacteria 2403
24 Ga0070707_101145242 3300005468 Bacteria 744
25 Ga0074259_11369253 3300005507 Bacteria 503
26 Ga0070679_100006366 3300005530 Bacteria 10996
27 Ga0068853_100078846 3300005539 Bacteria 2879
28 Ga0068853_100568908 3300005539 Bacteria 1075
29 Ga0070686_100100409 3300005544 Bacteria 1954
30 Ga0070665_100086798 3300005548 Bacteria 3134
31 Ga0070704_100005303 3300005549 Bacteria 7512
32 Ga0068870_10067515 3300005840 Bacteria 1940
33 Ga0068858_100178546 3300005842 Bacteria 2004
34 Ga0075428_100892427 3300006844 Unclassified 943
35 Ga0075428_101339089 3300006844 Bacteria 752
36 Ga0075431_100001948 3300006847 Bacteria 19700
37 Ga0075433_11207348 3300006852 Bacteria 656
38 Ga0075434_100002555 3300006871 Bacteria 16066
39 Ga0075434_100309210 3300006871 Bacteria 1601
40 Ga0075429_100094050 3300006880 Bacteria 2614
41 Ga0075436_100729281 3300006914 Bacteria 735
42 Ga0075435_101936309 3300007076 Bacteria 517
43 Ga0111539_10008084 3300009094 Bacteria 13406
44 Ga0111539_11254234 3300009094 Bacteria 860
45 Ga0114129_10052863 3300009147 Bacteria 5700
46 Ga0105242_10111998 3300009176 Bacteria 2328
47 Ga0105242_11579256 3300009176 Bacteria 689
48 Ga0105248_10438379 3300009177 Bacteria 1472
49 Ga0157373_10120998 3300013100 Bacteria 1840
50 Ga0157369_11112058 3300013105 Bacteria 807
51 Ga0157378_10364477 3300013297 Bacteria 1415
52 Ga0163163_12982453 3300014325 Bacteria 528
53 Ga0157380_10015352 3300014326 Bacteria 5629
54 Ga0157380_10183193 3300014326 Bacteria 1842
55 Ga0182008_10138855 3300014497 Bacteria 1215
56 Ga0163161_10025844 3300017792 Bacteria 4157
57 Ga0207699_10000010 3300025906 Bacteria 295869
58 Ga0207643_10040223 3300025908 Bacteria 2632
59 Ga0207705_11003499 3300025909 Bacteria 645
60 Ga0207662_10407502 3300025918 Bacteria 923
61 Ga0207652_10007392 3300025921 Bacteria 8856
62 Ga0207646_10344362 3300025922 Bacteria 1347
63 Ga0207650_10160919 3300025925 Bacteria 1778
64 Ga0207644_10484687 3300025931 Bacteria 1019
65 Ga0207690_10033585 3300025932 Bacteria 3300
66 Ga0207690_10715171 3300025932 Bacteria 824
67 Ga0207686_10086461 3300025934 Bacteria 2059
68 Ga0207670_10796091 3300025936 Bacteria 787
69 Ga0207669_10056776 3300025937 Bacteria 2380
70 Ga0207704_11564310 3300025938 Bacteria 566
71 Ga0207711_11376308 3300025941 Bacteria 648
72 Ga0207667_10093787 3300025949 Unclassified 3100
73 Ga0207651_10742735 3300025960 Bacteria 867
74 Ga0207639_10247545 3300026041 Bacteria 1553
75 Ga0207648_10013733 3300026089 Bacteria 7519
76 Ga0207698_10260765 3300026142 Bacteria 1592
77 Ga0207428_10024683 3300027907 Bacteria 5046
78 Ga0268266_10347939 3300028379 Bacteria 1392
79 Ga0265337_1001887 3300028556 Bacteria 9986
80 Ga0265318_10135918 3300028577 Unclassified 903
81 Ga0265320_10000078 3300031240 Bacteria 84397
82 Ga0265320_10053354 3300031240 Bacteria 1955
83 Ga0265320_10286711 3300031240 Bacteria 729
84 Ga0265316_10130387 3300031344 Bacteria 1894
85 Ga0265313_10186345 3300031595 Unclassified 870
86 Ga0265314_10103078 3300031711 Bacteria 1829
87 Ga0265314_10304695 3300031711 Unclassified 892
88 Ga0265342_10316352 3300031712 Bacteria 819
89 Ga0373933_0187621 3300035724 Bacteria 1320
90 Ga0373933_0916525 3300035724 Bacteria 577
91 Ga0373937_1147183 3300036401 Bacteria 726
92 Ga0395905_0116287 3300037471 Bacteria 2514
93 Ga0400487_27515 3300039110 Bacteria 45618
94 Ga0439465_0083897 3300041413 Bacteria 1083
95 Ga0451800_0858862 3300041459 Bacteria 873
96 Ga0451802_2070998 3300041460 Bacteria 1304
97 Ga0451807_2248575 3300041486 Bacteria 792
98 Ga0451851_0609990 3300041507 Bacteria 576
99 Ga0451853_2742636 3300041512 Bacteria 631
100 Ga0451577_0504228 3300042876 Unclassified 1099
101 Ga0451576_0257660 3300045051 Bacteria 1823
102 Ga0495630_0000017 3300046517 Bacteria 191957
103 Ga0501035_1451137 3300049822 Bacteria 524
104 Ga0501044_0000745 3300049823 Bacteria 39309
105 nmdc:mga05p37_147118_c1 3300050507 Bacteria 2883
106 nmdc:mga09592_137786_c1 3300050508 Bacteria 2103
107 nmdc:mga09592_16194_c1 3300050508 Bacteria 6094
108 nmdc:mga0qj67_894964_c1 3300050509 Bacteria 700
109 nmdc:mga08y16_1693483_c1 3300050511 Bacteria 588
110 nmdc:mga08y16_7511_c1 3300050511 Bacteria 11416
111 nmdc:mga0n895_315442_c1 3300050512 Bacteria 1584
112 nmdc:mga0n895_8312_c1 3300050512 Bacteria 8979
113 nmdc:mga08x19_113764_c1 3300050514 Bacteria 1807
114 2507506131 2507262055 Bacteria 8048963
115 2707098095 2706794495 Bacteria 4536932
116 2739305506 2738543023 Bacteria 6767879
117 2791925553 2791354903 Bacteria 4937680
118 2852106314 2852103415 Bacteria 5193810
119 2852392530 2852387548 Bacteria 8025568
120 2854605653 2854601825 Bacteria 4797592
121 2858467185 2858466076 Bacteria 4722413
122 2871273021 2871272651 Bacteria 5042015
123 2884700051 2884693830 Bacteria 11273186
124 2895450009 2895442618 Bacteria 11027144
125 2895501443 2895498888 Bacteria 5283788
126 2895527419 2895525241 Bacteria 3388457
127 2900053424 2900051742 Bacteria 4985156
128 2954012467 2954011201 Bacteria 4762601
129 3000377909 3000376612 Bacteria 4705565
130 8046770985 8046767195 Bacteria 7547379
131 8057580040 8057575449 Bacteria 7367519
132 Ga0495639_0042509
133 Ga0058692_1000019
134 Ga0065714_10271034
135 Ga0065714_10299731
136 Ga0065704_10126253
137 Ga0065707_10339591
138 Ga0070658_10936459
139 Ga0070690_100006509
140 Ga0070689_100889701
141 Ga0070687_100263138
142 Ga0070668_100306673
143 Ga0070671_100330363
144 Ga0070674_100346515
145 Ga0070673_100418537
146 Ga0070688_100955922
147 Ga0070659_101529620
148 Ga0070667_100183056
149 Ga0070709_10000057
150 Ga0070705_101088968
151 Ga0070694_100008684
152 Ga0070662_100652093
153 Ga0068867_100019857
154 Ga0070707_100134698
155 Ga0070707_101145242
156 Ga0074259_11369253
157 Ga0070679_100006366
158 Ga0068853_100078846
159 Ga0068853_100568908
160 Ga0070686_100100409
161 Ga0070665_100086798
162 Ga0070704_100005303
163 Ga0068870_10067515
164 Ga0068858_100178546
165 Ga0075428_100892427
166 Ga0075428_101339089
167 Ga0075431_100001948
168 Ga0075433_11207348
169 Ga0075434_100002555
170 Ga0075434_100309210
171 Ga0075429_100094050
172 Ga0075436_100729281
173 Ga0075435_101936309
174 Ga0111539_10008084
175 Ga0111539_11254234
176 Ga0114129_10052863
177 Ga0105242_10111998
178 Ga0105242_11579256
179 Ga0105248_10438379
180 Ga0157373_10120998
181 Ga0157369_11112058
182 Ga0157378_10364477
183 Ga0163163_12982453
184 Ga0157380_10015352
185 Ga0157380_10183193
186 Ga0182008_10138855
187 Ga0163161_10025844
188 Ga0207699_10000010
189 Ga0207643_10040223
190 Ga0207705_11003499
191 Ga0207662_10407502
192 Ga0207652_10007392
193 Ga0207646_10344362
194 Ga0207650_10160919
195 Ga0207644_10484687
196 Ga0207690_10033585
197 Ga0207690_10715171
198 Ga0207686_10086461
199 Ga0207670_10796091
200 Ga0207669_10056776
201 Ga0207704_11564310
202 Ga0207711_11376308
203 Ga0207667_10093787
204 Ga0207651_10742735
205 Ga0207639_10247545
206 Ga0207648_10013733
207 Ga0207698_10260765
208 Ga0207428_10024683
209 Ga0268266_10347939
210 Ga0265337_1001887
211 Ga0265318_10135918
212 Ga0265320_10000078
213 Ga0265320_10053354
214 Ga0265320_10286711
215 Ga0265316_10130387
216 Ga0265313_10186345
217 Ga0265314_10103078
218 Ga0265314_10304695
219 Ga0265342_10316352
220 Ga0373933_0187621
221 Ga0373933_0916525
222 Ga0373937_1147183
223 Ga0395905_0116287
224 Ga0400487_27515
225 Ga0439465_0083897
226 Ga0451800_0858862
227 Ga0451802_2070998
228 Ga0451807_2248575
229 Ga0451851_0609990
230 Ga0451853_2742636
231 Ga0451577_0504228
232 Ga0451576_0257660
233 Ga0495630_0000017
234 Ga0501035_1451137
235 Ga0501044_0000745
236 nmdc:mga05p37_147118_c1
237 nmdc:mga09592_137786_c1
238 nmdc:mga09592_16194_c1
239 nmdc:mga0qj67_894964_c1
240 nmdc:mga08y16_1693483_c1
241 nmdc:mga08y16_7511_c1
242 nmdc:mga0n895_315442_c1
243 nmdc:mga0n895_8312_c1
244 nmdc:mga08x19_113764_c1
245 2507506131
246 2707098095
247 2739305506
248 2791925553
249 2852106314
250 2852392530
251 2854605653
252 2858467185
253 2871273021
254 2884700051
255 2895450009
256 2895501443
257 2895527419
258 2900053424
259 2954012467
260 3000377909
261 8046770985
262 8057580040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

9

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntm-assembly1.cif.gz_A qued soaked with sepiapterin (selenomethionine substituted protein) 0.9921 1 117
4ntk-assembly1.cif.gz_D qued from e. coli 0.9895 1 118
3qn9-assembly1.cif.gz_A crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli 0.9894 1 115
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.9888 1 118
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.985 1 115
ID Description Score Start End Superfamily
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9917 1 117 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.974 1 117 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9238 1 118 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9164 1 118 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9061 1 118 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A441UM70-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9983 1 118 GO:0008616
GO:0046872
GO:0070497
AF-A0A5C8SN62-F1-model_v4 deleted 0.9971 1 118
AF-A0A7R6XKL1-F1-model_v4 deleted 0.9969 27 117
AF-A0A3M5BAS0-F1-model_v4 deleted 0.9968 1 97
AF-A0A3S1HB48-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.995 1 117 GO:0008616
GO:0046872
GO:0070497

Map