F148084

General Info

Members Datasets Scaffolds Average Seq Length
131 92 130 391

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100121862|Ga0070680_1001218622
Length 410
Sequence MAATMTFQYSVRDKAGKLVSGTLEADSQTAVAQRLKAMGYAPVSISASNAGLKKEISIPGLSRKKKVKLKDLAVFSRQFATMINSGLSLLRALNILAEQTESDELKRVIGEVRNEVESGTSLSAAMGKHPRVFPPLMVNMTKAGEVGGFLDSVLLQIAENYEAEVKLRGKIKSAMTYPIVVACISGIALIVMLTFVVPTFAKMFKSLGSKLPAPTQLLVNLSHAMKFLLPAAIIFTIVFLIVWKRIKHEERVRKVVDPLKLKVPVFGMLFRKVALARFARNLGTMIRSGVPILQALDIVADTTGNYTLTAAVHDVQDSVRQGESLTRPLENHPVFPPMVVQMMAVGEDTGALDTMLHKISDFYDQEVEATTEALTALIEPIMIAVLGGLVGSMIVCLYLPIFDIYNHIGG

Samples

Sample ID Description Type Environment
1 2643221679 Angustibacter sp. Root456 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
79 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
92 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.76
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 5.34
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010956 3300003203 Bacteria 3990
2 Ga0058862_10023106 3300004803 Bacteria 3208
3 Ga0070658_10000370 3300005327 Bacteria 39203
4 Ga0070658_10006201 3300005327 Bacteria 9693
5 Ga0070658_10139880 3300005327 Bacteria 2022
6 Ga0070683_100139357 3300005329 Bacteria 2297
7 Ga0068869_100073067 3300005334 Bacteria 2543
8 Ga0070680_100004597 3300005336 Bacteria 10375
9 Ga0070680_100121862 3300005336 Bacteria 2177
10 Ga0070688_100064908 3300005365 Bacteria 2318
11 Ga0070659_100007973 3300005366 Bacteria 7718
12 Ga0070659_100053834 3300005366 Bacteria 3168
13 Ga0070705_100041637 3300005440 Bacteria 2620
14 Ga0070708_100002070 3300005445 Bacteria 15470
15 Ga0070708_100020892 3300005445 Bacteria 5528
16 Ga0070681_10000314 3300005458 Bacteria 39339
17 Ga0070681_10044875 3300005458 Bacteria 4425
18 Ga0070707_100214120 3300005468 Bacteria 1877
19 Ga0070707_100301297 3300005468 Bacteria 1557
20 Ga0070679_100000345 3300005530 Bacteria 39339
21 Ga0070679_100125565 3300005530 Bacteria 2548
22 Ga0070679_100184524 3300005530 Bacteria 2058
23 Ga0070684_100207091 3300005535 Bacteria 1787
24 Ga0070697_100195775 3300005536 Bacteria 1716
25 Ga0068855_100007401 3300005563 Bacteria 13289
26 Ga0068863_100130433 3300005841 Bacteria 2400
27 Ga0081455_10000115 3300005937 Bacteria 91703
28 Ga0081539_10000352 3300005985 Bacteria 100942
29 Ga0075428_100018784 3300006844 Bacteria 7644
30 Ga0105240_10032297 3300009093 Bacteria 6780
31 Ga0111539_10322800 3300009094 Bacteria 1797
32 Ga0105248_10548390 3300009177 Bacteria 1304
33 Ga0105238_10145504 3300009551 Bacteria 2346
34 Ga0105246_10081509 3300011119 Bacteria 2307
35 Ga0157313_1000572 3300012503 Bacteria 1728
36 Ga0157373_10078350 3300013100 Bacteria 2330
37 Ga0157370_10006340 3300013104 Bacteria 13068
38 Ga0157370_10111076 3300013104 Bacteria 2562
39 Ga0157370_10276175 3300013104 Bacteria 1552
40 Ga0157369_10005564 3300013105 Bacteria 14628
41 Ga0157369_10039907 3300013105 Bacteria 5128
42 Ga0157369_10059772 3300013105 Bacteria 4110
43 Ga0157369_10077372 3300013105 Bacteria 3566
44 Ga0157369_10079366 3300013105 Bacteria 3515
45 Ga0157369_10240737 3300013105 Bacteria 1890
46 Ga0157378_10298598 3300013297 Bacteria 1558
47 Ga0163162_10326828 3300013306 Bacteria 1666
48 Ga0157372_10232086 3300013307 Bacteria 2139
49 Ga0157372_10401985 3300013307 Bacteria 1596
50 Ga0157375_10107556 3300013308 Bacteria 2882
51 Ga0157375_10304374 3300013308 Bacteria 1758
52 Ga0163163_10004368 3300014325 Bacteria 12044
53 Ga0213876_10016684 3300021384 Bacteria 3880
54 Ga0207705_10000819 3300025909 Bacteria 25442
55 Ga0207705_10005092 3300025909 Bacteria 9854
56 Ga0207705_10009659 3300025909 Bacteria 7017
57 Ga0207705_10059942 3300025909 Bacteria 2748
58 Ga0207684_10013568 3300025910 Bacteria 7043
59 Ga0207707_10000325 3300025912 Bacteria 50164
60 Ga0207707_10134876 3300025912 Bacteria 2158
61 Ga0207695_10024969 3300025913 Bacteria 6706
62 Ga0207660_10001513 3300025917 Bacteria 15639
63 Ga0207660_10017504 3300025917 Bacteria 4762
64 Ga0207657_10142252 3300025919 Bacteria 1959
65 Ga0207652_10000155 3300025921 Bacteria 74494
66 Ga0207652_10005768 3300025921 Bacteria 10046
67 Ga0207652_10052564 3300025921 Bacteria 3497
68 Ga0207652_10185555 3300025921 Bacteria 1870
69 Ga0207646_10141523 3300025922 Bacteria 2167
70 Ga0207646_10224790 3300025922 Bacteria 1696
71 Ga0207646_10289148 3300025922 Bacteria 1481
72 Ga0207690_10005134 3300025932 Bacteria 7728
73 Ga0207690_10039388 3300025932 Bacteria 3083
74 Ga0207704_10082320 3300025938 Bacteria 2085
75 Ga0207689_10062072 3300025942 Bacteria 3073
76 Ga0207661_10040930 3300025944 Bacteria 3646
77 Ga0207641_10257820 3300026088 Bacteria 1631
78 Ga0265338_10021596 3300028800 Bacteria 6706
79 Ga0265338_10193358 3300028800 Bacteria 1540
80 Ga0265320_10009543 3300031240 Bacteria 5846
81 Ga0265325_10024480 3300031241 Bacteria 3284
82 Ga0265340_10003346 3300031247 Bacteria 9082
83 Ga0265339_10007108 3300031249 Bacteria 7268
84 Ga0265313_10018313 3300031595 Bacteria 3937
85 Ga0265342_10072289 3300031712 Bacteria 2008
86 Ga0373937_0080081 3300036401 Bacteria 3020
87 Ga0373925_0336757 3300037068 Bacteria 1223
88 Ga0395899_0000390 3300037312 Bacteria 52344
89 Ga0395901_0045478 3300038443 Bacteria 4556
90 Ga0436365_0502318 3300039437 Bacteria 3928
91 Ga0466961_0097873 3300044693 Bacteria 1850
92 Ga0466960_0037481 3300044901 Bacteria 2274
93 Ga0466958_0081028 3300045836 Bacteria 1997
94 Ga0466967_0101719 3300045976 Bacteria 2627
95 Ga0466967_0415332 3300045976 Bacteria 1311
96 Ga0495592_0038682 3300046454 Bacteria 3587
97 Ga0495608_0021825 3300046511 Bacteria 4391
98 Ga0495628_0024719 3300046516 Bacteria 4914
99 Ga0495628_0034638 3300046516 Bacteria 4060
100 Ga0495630_0201722 3300046517 Bacteria 1518
101 Ga0495667_0000794 3300046559 Bacteria 20315
102 Ga0495613_0091044 3300046689 Bacteria 2209
103 Ga0495684_0003593 3300047471 Bacteria 12097
104 Ga0496104_0191493 3300048907 Bacteria 1957
105 Ga0496108_0159108 3300048911 Bacteria 1951
106 Ga0496109_0018676 3300048912 Bacteria 6094
107 Ga0496109_0095109 3300048912 Bacteria 2758
108 Ga0496110_0093837 3300048913 Bacteria 2687
109 Ga0496110_0174388 3300048913 Bacteria 1951
110 Ga0496113_0081440 3300048916 Bacteria 2481
111 Ga0496122_0000275 3300048925 Bacteria 114580
112 Ga0496123_0000166 3300048926 Bacteria 131527
113 Ga0496126_0000022 3300048929 Bacteria 464393
114 Ga0501034_0001163 3300049571 Bacteria 36455
115 Ga0501034_0067180 3300049571 Bacteria 3599
116 Ga0501047_0000088 3300049581 Bacteria 117495
117 Ga0501070_0004958 3300049586 Bacteria 11362
118 Ga0501070_0013735 3300049586 Bacteria 6821
119 Ga0501070_0141611 3300049586 Bacteria 1985
120 Ga0501071_0162042 3300049587 Bacteria 1672
121 Ga0501074_0017826 3300049590 Bacteria 5160
122 Ga0501079_0137412 3300049741 Bacteria 1903
123 Ga0501080_0053264 3300049742 Bacteria 3766
124 Ga0501080_0073532 3300049742 Bacteria 3180
125 Ga0501080_0177273 3300049742 Bacteria 1963
126 nmdc:mga09592_226834_c1 3300050508 Bacteria 1618
127 nmdc:mga08y16_299383_c1 3300050511 Bacteria 1658
128 Ga0500568_0018946 3300053139 Bacteria 3002
129 Ga0500620_008305 3300053155 Bacteria 2616
130 Ga0530510_0009341 3300061734 Bacteria 6877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10232086 Ga0157372_102320863 320
2 3300025938 Ga0207704_10082320 Ga0207704_100823202 322
3 3300009177 Ga0105248_10548390 Ga0105248_105483902 346
4 3300005468 Ga0070707_100301297 Ga0070707_1003012971 348
5 3300046689 Ga0495613_0091044 Ga0495613_0091044_963_2135 349
6 3300013297 Ga0157378_10298598 Ga0157378_102985982 351
7 3300009551 Ga0105238_10145504 Ga0105238_101455042 352
8 3300011119 Ga0105246_10081509 Ga0105246_100815093 352
9 3300025922 Ga0207646_10289148 Ga0207646_102891481 354
10 3300005458 Ga0070681_10000314 Ga0070681_1000031410 355
11 3300005530 Ga0070679_100000345 Ga0070679_10000034528 355
12 3300025912 Ga0207707_10000325 Ga0207707_1000032527 355
13 3300025917 Ga0207660_10001513 Ga0207660_1000151310 355
14 3300025921 Ga0207652_10000155 Ga0207652_1000015527 355
15 3300009094 Ga0111539_10322800 Ga0111539_103228002 358
16 3300037068 Ga0373925_0336757 Ga0373925_0336757_20_1147 358
17 3300048929 Ga0496126_0000022 Ga0496126_0000022_1393_2613 359
18 3300005329 Ga0070683_100139357 Ga0070683_1001393572 360
19 3300005535 Ga0070684_100207091 Ga0070684_1002070911 360
20 3300025944 Ga0207661_10040930 Ga0207661_100409304 360
21 3300046516 Ga0495628_0034638 Ga0495628_0034638_2103_3347 360
22 3300046517 Ga0495630_0201722 Ga0495630_0201722_124_1368 360
23 3300047471 Ga0495684_0003593 Ga0495684_0003593_6055_7299 360
24 3300009093 Ga0105240_10032297 Ga0105240_100322971 361
25 3300013104 Ga0157370_10006340 Ga0157370_100063404 361
26 3300013105 Ga0157369_10005564 Ga0157369_1000556417 361
27 3300025913 Ga0207695_10024969 Ga0207695_100249695 361
28 3300046511 Ga0495608_0021825 Ga0495608_0021825_2061_3308 361
29 3300046559 Ga0495667_0000794 Ga0495667_0000794_16371_17618 361
30 3300053155 Ga0500620_008305 Ga0500620_008305_731_1948 362
31 3300005458 Ga0070681_10044875 Ga0070681_100448753 363
32 3300048913 Ga0496110_0093837 Ga0496110_0093837_206_1432 364
33 3300005841 Ga0068863_100130433 Ga0068863_1001304332 366
34 3300026088 Ga0207641_10257820 Ga0207641_102578202 366
35 3300005327 Ga0070658_10006201 Ga0070658_100062013 367
36 3300025909 Ga0207705_10005092 Ga0207705_100050924 367
37 3300038443 Ga0395901_0045478 Ga0395901_0045478_3311_4531 367
38 3300004803 Ga0058862_10023106 Ga0058862_100231062 368
39 3300005327 Ga0070658_10139880 Ga0070658_101398801 368
40 3300005336 Ga0070680_100004597 Ga0070680_1000045978 368
41 3300013306 Ga0163162_10326828 Ga0163162_103268282 368
42 3300025909 Ga0207705_10059942 Ga0207705_100599421 368
43 3300025917 Ga0207660_10017504 Ga0207660_100175044 368
44 3300025921 Ga0207652_10005768 Ga0207652_100057686 368
45 3300005563 Ga0068855_100007401 Ga0068855_10000740110 369
46 3300013100 Ga0157373_10078350 Ga0157373_100783503 369
47 3300013104 Ga0157370_10111076 Ga0157370_101110761 369
48 3300013307 Ga0157372_10401985 Ga0157372_104019851 369
49 3300025921 Ga0207652_10185555 Ga0207652_101855552 369
50 3300045976 Ga0466967_0415332 Ga0466967_0415332_52_1278 369
51 3300049586 Ga0501070_0141611 Ga0501070_0141611_41_1264 370
52 3300021384 Ga0213876_10016684 Ga0213876_100166842 371
53 3300039437 Ga0436365_0502318 Ga0436365_0502318_490_1716 371
54 3300049581 Ga0501047_0000088 Ga0501047_0000088_107594_108814 372
55 3300028800 Ga0265338_10021596 Ga0265338_100215965 373
56 3300031240 Ga0265320_10009543 Ga0265320_100095434 373
57 3300031241 Ga0265325_10024480 Ga0265325_100244802 373
58 3300031247 Ga0265340_10003346 Ga0265340_100033463 373
59 3300031249 Ga0265339_10007108 Ga0265339_100071085 373
60 3300031595 Ga0265313_10018313 Ga0265313_100183133 373
61 3300048907 Ga0496104_0191493 Ga0496104_0191493_714_1940 373
62 3300013104 Ga0157370_10276175 Ga0157370_102761752 377
63 3300037312 Ga0395899_0000390 Ga0395899_0000390_33946_35169 379
64 3300053139 Ga0500568_0018946 Ga0500568_0018946_183_1406 379
65 3300005445 Ga0070708_100020892 Ga0070708_1000208922 382
66 3300005468 Ga0070707_100214120 Ga0070707_1002141202 382
67 3300025922 Ga0207646_10224790 Ga0207646_102247902 382
68 3300045976 Ga0466967_0101719 Ga0466967_0101719_1270_2490 382
69 3300050508 nmdc:mga09592_226834_c1 nmdc:mga09592_226834_c1_110_1360 382
70 3300050511 nmdc:mga08y16_299383_c1 nmdc:mga08y16_299383_c1_196_1440 382
71 3300013105 Ga0157369_10077372 Ga0157369_100773723 383
72 3300049587 Ga0501071_0162042 Ga0501071_0162042_208_1428 387
73 3300061734 Ga0530510_0009341 Ga0530510_0009341_2637_3857 387
74 3300013308 Ga0157375_10107556 Ga0157375_101075561 390
75 3300014325 Ga0163163_10004368 Ga0163163_100043682 390
76 3300048911 Ga0496108_0159108 Ga0496108_0159108_427_1650 390
77 3300048912 Ga0496109_0018676 Ga0496109_0018676_1334_2557 390
78 3300048913 Ga0496110_0174388 Ga0496110_0174388_439_1662 390
79 3300048916 Ga0496113_0081440 Ga0496113_0081440_986_2209 390
80 iso_pu_bacteria 2643221679 2644445258 390
81 3300005365 Ga0070688_100064908 Ga0070688_1000649082 392
82 3300005445 Ga0070708_100002070 Ga0070708_10000207010 392
83 3300005536 Ga0070697_100195775 Ga0070697_1001957751 392
84 3300006844 Ga0075428_100018784 Ga0075428_1000187847 392
85 3300025910 Ga0207684_10013568 Ga0207684_100135683 392
86 3300025922 Ga0207646_10141523 Ga0207646_101415232 392
87 3300046454 Ga0495592_0038682 Ga0495592_0038682_1233_2477 392
88 3300046516 Ga0495628_0024719 Ga0495628_0024719_1615_2859 392
89 3300049571 Ga0501034_0001163 Ga0501034_0001163_32521_33750 392
90 3300005440 Ga0070705_100041637 Ga0070705_1000416372 393
91 3300013105 Ga0157369_10240737 Ga0157369_102407371 393
92 3300028800 Ga0265338_10193358 Ga0265338_101933582 393
93 3300031712 Ga0265342_10072289 Ga0265342_100722892 393
94 3300036401 Ga0373937_0080081 Ga0373937_0080081_69_1289 393
95 3300049571 Ga0501034_0067180 Ga0501034_0067180_400_1662 393
96 3300005327 Ga0070658_10000370 Ga0070658_1000037028 394
97 3300012503 Ga0157313_1000572 Ga0157313_10005722 394
98 3300025909 Ga0207705_10000819 Ga0207705_1000081926 394
99 3300025909 Ga0207705_10009659 Ga0207705_100096593 394
100 3300044901 Ga0466960_0037481 Ga0466960_0037481_780_2000 394
101 3300049586 Ga0501070_0004958 Ga0501070_0004958_621_1844 394
102 3300049586 Ga0501070_0013735 Ga0501070_0013735_2942_4165 394
103 3300049590 Ga0501074_0017826 Ga0501074_0017826_520_1743 394
104 3300049741 Ga0501079_0137412 Ga0501079_0137412_640_1863 394
105 3300049742 Ga0501080_0053264 Ga0501080_0053264_1539_2762 394
106 3300049742 Ga0501080_0073532 Ga0501080_0073532_129_1352 394
107 3300049742 Ga0501080_0177273 Ga0501080_0177273_71_1294 394
108 3300003203 JGI25406J46586_10010956 JGI25406J46586_100109563 395
109 3300005334 Ga0068869_100073067 Ga0068869_1000730672 395
110 3300005336 Ga0070680_100121862 Ga0070680_1001218622 395
111 3300005366 Ga0070659_100007973 Ga0070659_1000079737 395
112 3300005366 Ga0070659_100053834 Ga0070659_1000538344 395
113 3300005530 Ga0070679_100125565 Ga0070679_1001255652 395
114 3300005530 Ga0070679_100184524 Ga0070679_1001845242 395
115 3300005937 Ga0081455_10000115 Ga0081455_1000011526 395
116 3300005985 Ga0081539_10000352 Ga0081539_1000035295 395
117 3300013105 Ga0157369_10039907 Ga0157369_100399073 395
118 3300013105 Ga0157369_10059772 Ga0157369_100597725 395
119 3300013105 Ga0157369_10079366 Ga0157369_100793662 395
120 3300013308 Ga0157375_10304374 Ga0157375_103043742 395
121 3300025912 Ga0207707_10134876 Ga0207707_101348762 395
122 3300025919 Ga0207657_10142252 Ga0207657_101422522 395
123 3300025921 Ga0207652_10052564 Ga0207652_100525642 395
124 3300025932 Ga0207690_10005134 Ga0207690_100051343 395
125 3300025932 Ga0207690_10039388 Ga0207690_100393884 395
126 3300025942 Ga0207689_10062072 Ga0207689_100620722 395
127 3300044693 Ga0466961_0097873 Ga0466961_0097873_237_1463 395
128 3300045836 Ga0466958_0081028 Ga0466958_0081028_62_1288 395
129 3300048912 Ga0496109_0095109 Ga0496109_0095109_1410_2633 395
130 3300048925 Ga0496122_0000275 Ga0496122_0000275_668_1894 395
131 3300048926 Ga0496123_0000166 Ga0496123_0000166_121535_122761 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

278

400

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

75

198

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9774 65 164
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.9723 63 164
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9619 64 174
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9596 63 174
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9583 64 169
ID Description Score Start End Superfamily
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9774 65 164 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9365 64 174 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9333 65 174 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9313 65 164 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9264 259 351 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A7R8ZZ00-F1-model_v4 Uncharacterized protein 0.8957 233 376 GO:0005886
AF-A0A7Z9PV31-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8832 52 163 GO:0005886
AF-A0A7R8ZZ00-F1-model_v4 Uncharacterized protein 0.8785 233 376 GO:0005886
AF-A0A7W1UNV1-F1-model_v4 Type II secretion system F family protein 0.8662 53 183 GO:0005886
AF-A0A1V6E990-F1-model_v4 Type II secretion system protein F 0.8556 64 394 GO:0005886
GO:0009306

Feature Viewer

pLDDT pTM Quality
79.24 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map