F147155

General Info

Members Datasets Scaffolds Average Seq Length
130 84 109 203

Family's Representative Sequence

Representative Sequence 3300050495|nmdc:mga04h51_22180_c1|nmdc:mga04h51_22180_c1_670_1371
Length 233
Sequence VHEQQRCRVRVAAGRTPYDVEGWMLGHRDILVVMSPSRQRFRGRIAGVGSTSGIRVVIGSWVDTPLGAFGDAMVETAAGHRVLLAPHQAAADFITATYAFDETRIEQFQVDDRWQVRSPSLYVDLTIGARTALGLALRSVPRRVAESPAWCTLTDPVARVVLRGVRTRGTAGNGRREWYGATDTRQVTGLSGWFDGTDLGELAEVDPPCTFGFSSTPRRPSVTTVVTTVEVRE

Samples

Sample ID Description Type Environment
1 2643221641 Nocardioides sp. Root122 Isolate Unclassified
2 2643221711 Terrabacter sp. Root85 Isolate Unclassified
3 2739367898 Nocardioides sp. CF479 Isolate Unclassified
4 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
5 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
6 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
7 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
8 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
9 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
10 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
11 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
12 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
13 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
14 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
15 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
16 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
17 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
18 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
19 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
20 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
55 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
56 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
61 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
72 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
82 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
83 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
84 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.85
Metatranscriptomes 0
Isolates 16.15

Biome Distribution

Category Percentage (%)
Aerial Root 2.31
Bulb 0
Endosphere 37.69
Nodule 0
Rhizoplane 13.85
Rhizosphere 35.38
Stem 0
Stem Tuber 0
Unclassified 10.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000998 3300005327 Bacteria 24272
2 Ga0070670_100875470 3300005331 Bacteria 813
3 Ga0070680_100389320 3300005336 Bacteria 1187
4 Ga0070714_100003188 3300005435 Bacteria 12195
5 Ga0070678_100891863 3300005456 Bacteria 812
6 Ga0075365_10000980 3300006038 Bacteria 12154
7 Ga0075365_10005811 3300006038 Bacteria 6703
8 Ga0075365_10016120 3300006038 Bacteria 4536
9 Ga0075365_10029652 3300006038 Bacteria 3499
10 Ga0075365_10080909 3300006038 Bacteria 2200
11 Ga0075365_10177532 3300006038 Bacteria 1488
12 Ga0075365_10196268 3300006038 Bacteria 1413
13 Ga0075365_10252529 3300006038 Bacteria 1239
14 Ga0075365_10414378 3300006038 Bacteria 951
15 Ga0075368_10004394 3300006042 Bacteria 4777
16 Ga0075368_10019411 3300006042 Bacteria 2566
17 Ga0075368_10056727 3300006042 Bacteria 1563
18 Ga0075368_10169927 3300006042 Bacteria 916
19 Ga0075363_100002789 3300006048 Bacteria 7252
20 Ga0075363_100034576 3300006048 Bacteria 2639
21 Ga0075363_100035487 3300006048 Bacteria 2610
22 Ga0075363_100042558 3300006048 Bacteria 2400
23 Ga0075363_100242350 3300006048 Bacteria 1037
24 Ga0075364_10017826 3300006051 Bacteria 4439
25 Ga0075364_10030649 3300006051 Bacteria 3452
26 Ga0075364_10045121 3300006051 Bacteria 2868
27 Ga0075364_10135609 3300006051 Bacteria 1653
28 Ga0075364_10142178 3300006051 Bacteria 1614
29 Ga0075364_10198990 3300006051 Bacteria 1358
30 Ga0075364_10329034 3300006051 Bacteria 1041
31 Ga0075362_10010584 3300006177 Bacteria 3606
32 Ga0075367_10017172 3300006178 Bacteria 3967
33 Ga0075367_10017494 3300006178 Bacteria 3935
34 Ga0075367_10157976 3300006178 Bacteria 1409
35 Ga0075367_10169282 3300006178 Bacteria 1360
36 Ga0075370_10039863 3300006353 Bacteria 2648
37 Ga0105245_10312028 3300009098 Bacteria 1547
38 Ga0157372_10371786 3300013307 Unclassified 1666
39 Ga0207705_10082237 3300025909 Bacteria 2348
40 Ga0207659_10211355 3300025926 Bacteria 1555
41 Ga0207674_10194172 3300026116 Bacteria 1980
42 Ga0209813_10031324 3300027866 Bacteria 1569
43 Ga0268264_10000208 3300028381 Bacteria 119631
44 Ga0268264_10000272 3300028381 Bacteria 89651
45 Ga0307408_100256142 3300031548 Bacteria 1446
46 Ga0307405_10065751 3300031731 Bacteria 2310
47 Ga0307409_100095278 3300031995 Bacteria 2452
48 Ga0307416_100008939 3300032002 Bacteria 6513
49 Ga0307416_100039248 3300032002 Bacteria 3663
50 Ga0466965_0066375 3300044683 Bacteria 1809
51 Ga0466966_0070263 3300044684 Bacteria 2195
52 Ga0466961_0064838 3300044693 Bacteria 2321
53 Ga0466961_0089041 3300044693 Bacteria 1950
54 Ga0466963_0024441 3300044694 Bacteria 3847
55 Ga0466971_0151342 3300044719 Bacteria 1083
56 Ga0466968_0167557 3300044735 Bacteria 1017
57 Ga0466957_0002895 3300044842 Bacteria 9299
58 Ga0466957_0109761 3300044842 Bacteria 1748
59 Ga0466960_0069977 3300044901 Bacteria 1745
60 Ga0466958_0604766 3300045836 Bacteria 713
61 Ga0466967_0434801 3300045976 Bacteria 1280
62 Ga0495594_0081584 3300046499 Bacteria 1806
63 Ga0496100_0017184 3300048903 Bacteria 4266
64 Ga0496100_0407709 3300048903 Bacteria 1036
65 Ga0496101_0000566 3300048904 Bacteria 22650
66 Ga0496102_0004608 3300048905 Bacteria 11665
67 Ga0496102_0511796 3300048905 Bacteria 1123
68 Ga0496103_0001448 3300048906 Bacteria 15891
69 Ga0496103_0172854 3300048906 Bacteria 1387
70 Ga0496104_0001552 3300048907 Bacteria 19789
71 Ga0496104_0134221 3300048907 Bacteria 2378
72 Ga0496104_0635986 3300048907 Bacteria 976
73 Ga0496105_0011705 3300048908 Bacteria 6940
74 Ga0496105_0035290 3300048908 Bacteria 4116
75 Ga0496107_0114160 3300048910 Bacteria 1987
76 Ga0496110_0776001 3300048913 Bacteria 862
77 Ga0496110_1001896 3300048913 Bacteria 743
78 Ga0496112_0534553 3300048915 Bacteria 1107
79 Ga0496113_0050401 3300048916 Bacteria 3104
80 Ga0496114_0004313 3300048917 Bacteria 11004
81 Ga0496118_0401403 3300048921 Bacteria 712
82 Ga0496124_0416073 3300048927 Bacteria 928
83 Ga0496126_0682815 3300048929 Bacteria 800
84 Ga0501031_0280954 3300049568 Bacteria 1080
85 Ga0501036_0223231 3300049572 Bacteria 1582
86 Ga0501067_0528898 3300049583 Bacteria 660
87 Ga0501069_0050785 3300049585 Bacteria 2306
88 Ga0501072_0200785 3300049588 Bacteria 1590
89 Ga0501073_0347301 3300049589 Bacteria 1024
90 Ga0501080_1151836 3300049742 Bacteria 668
91 Ga0501081_0569300 3300049743 Bacteria 847
92 nmdc:mga03n38_106626_c1 3300050490 Bacteria 1359
93 nmdc:mga03n38_158147_c2 3300050490 Bacteria 795
94 nmdc:mga03n38_191358_c1 3300050490 Bacteria 1054
95 nmdc:mga00v17_25641_c1 3300050491 Bacteria 3428
96 nmdc:mga00v17_278812_c1 3300050491 Bacteria 1085
97 nmdc:mga00v17_9609_c1 3300050491 Bacteria 5243
98 nmdc:mga0yw44_11465_c1 3300050492 Bacteria 4578
99 nmdc:mga0yw44_121964_c1 3300050492 Bacteria 1679
100 nmdc:mga0yw44_393262_c1 3300050492 Bacteria 937
101 nmdc:mga0yw44_43121_c1 3300050492 Bacteria 2692
102 nmdc:mga0yw44_48058_c1 3300050492 Bacteria 2571
103 nmdc:mga06z11_16922_c1 3300050494 Bacteria 3297
104 nmdc:mga06z11_201617_c1 3300050494 Bacteria 1156
105 nmdc:mga04h51_22180_c1 3300050495 Bacteria 1919
106 nmdc:mga04h51_30904_c1 3300050495 Bacteria 1689
107 nmdc:mga07m45_268448_c1 3300050496 Bacteria 993
108 Ga0500644_0000136 3300053088 Bacteria 45421
109 Ga0466962_0018584 3300061719 Bacteria 3344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0528898 Ga0501067_0528898_76_606 147
2 3300006038 Ga0075365_10177532 Ga0075365_101775322 155
3 3300006178 Ga0075367_10157976 Ga0075367_101579762 155
4 3300048903 Ga0496100_0407709 Ga0496100_0407709_178_717 155
5 3300048906 Ga0496103_0172854 Ga0496103_0172854_204_743 155
6 3300048907 Ga0496104_0134221 Ga0496104_0134221_1393_1932 155
7 3300048916 Ga0496113_0050401 Ga0496113_0050401_58_597 155
8 3300006042 Ga0075368_10169927 Ga0075368_101699272 171
9 3300025926 Ga0207659_10211355 Ga0207659_102113552 171
10 3300050491 nmdc:mga00v17_278812_c1 nmdc:mga00v17_278812_c1_283_825 172
11 3300049588 Ga0501072_0200785 Ga0501072_0200785_263_862 179
12 3300006051 Ga0075364_10329034 Ga0075364_103290341 182
13 iso_pu_bacteria 2818991318 2819425818 185
14 iso_pu_bacteria 2818991318 2819428587 185
15 3300044901 Ga0466960_0069977 Ga0466960_0069977_938_1561 187
16 iso_pu_bacteria 2904765812 2904767696 187
17 iso_pu_bacteria 2904770941 2904774527 187
18 iso_pu_bacteria 2908811453 2908813340 187
19 iso_pu_bacteria 2919420072 2919424682 187
20 iso_pu_bacteria 2919432681 2919436937 187
21 iso_pu_bacteria 2984576629 2984578337 187
22 iso_pu_bacteria 2990256926 2990260816 187
23 iso_pu_bacteria 2811994882 2812373026 188
24 iso_pu_bacteria 2818991458 2819664902 188
25 iso_pu_bacteria 2818991462 2819689455 188
26 iso_pu_bacteria 2818991469 2819727000 188
27 3300005435 Ga0070714_100003188 Ga0070714_10000318819 189
28 3300006038 Ga0075365_10000980 Ga0075365_100009802 189
29 3300006038 Ga0075365_10196268 Ga0075365_101962682 189
30 3300006048 Ga0075363_100042558 Ga0075363_1000425582 189
31 3300006051 Ga0075364_10030649 Ga0075364_100306493 189
32 3300006353 Ga0075370_10039863 Ga0075370_100398634 189
33 3300013307 Ga0157372_10371786 Ga0157372_103717862 189
34 3300049742 Ga0501080_1151836 Ga0501080_1151836_67_657 189
35 3300050491 nmdc:mga00v17_25641_c1 nmdc:mga00v17_25641_c1_1043_1651 189
36 3300050496 nmdc:mga07m45_268448_c1 nmdc:mga07m45_268448_c1_66_674 189
37 3300005331 Ga0070670_100875470 Ga0070670_1008754702 190
38 3300006038 Ga0075365_10005811 Ga0075365_100058111 190
39 3300006038 Ga0075365_10016120 Ga0075365_100161203 190
40 3300006038 Ga0075365_10080909 Ga0075365_100809091 190
41 3300006042 Ga0075368_10004394 Ga0075368_100043946 190
42 3300006042 Ga0075368_10019411 Ga0075368_100194112 190
43 3300006048 Ga0075363_100002789 Ga0075363_1000027894 190
44 3300006051 Ga0075364_10045121 Ga0075364_100451213 190
45 3300006051 Ga0075364_10198990 Ga0075364_101989902 190
46 3300006177 Ga0075362_10010584 Ga0075362_100105844 190
47 3300006178 Ga0075367_10017172 Ga0075367_100171723 190
48 3300006178 Ga0075367_10169282 Ga0075367_101692822 190
49 3300031548 Ga0307408_100256142 Ga0307408_1002561422 190
50 3300048921 Ga0496118_0401403 Ga0496118_0401403_74_688 190
51 3300050492 nmdc:mga0yw44_11465_c1 nmdc:mga0yw44_11465_c1_1086_1691 190
52 3300050492 nmdc:mga0yw44_121964_c1 nmdc:mga0yw44_121964_c1_1064_1666 190
53 3300050492 nmdc:mga0yw44_48058_c1 nmdc:mga0yw44_48058_c1_1897_2493 190
54 3300050495 nmdc:mga04h51_22180_c1 nmdc:mga04h51_22180_c1_670_1371 190
55 3300053088 Ga0500644_0000136 Ga0500644_0000136_18381_19025 190
56 iso_pu_bacteria 2739367898 2740169471 190
57 3300005327 Ga0070658_10000998 Ga0070658_100009982 191
58 3300005336 Ga0070680_100389320 Ga0070680_1003893202 191
59 3300005456 Ga0070678_100891863 Ga0070678_1008918632 191
60 3300006038 Ga0075365_10029652 Ga0075365_100296524 191
61 3300006038 Ga0075365_10252529 Ga0075365_102525292 191
62 3300006038 Ga0075365_10414378 Ga0075365_104143782 191
63 3300006042 Ga0075368_10056727 Ga0075368_100567272 191
64 3300006048 Ga0075363_100034576 Ga0075363_1000345762 191
65 3300006048 Ga0075363_100035487 Ga0075363_1000354874 191
66 3300006048 Ga0075363_100242350 Ga0075363_1002423502 191
67 3300006051 Ga0075364_10017826 Ga0075364_100178265 191
68 3300006051 Ga0075364_10135609 Ga0075364_101356092 191
69 3300006051 Ga0075364_10142178 Ga0075364_101421783 191
70 3300006178 Ga0075367_10017494 Ga0075367_100174942 191
71 3300009098 Ga0105245_10312028 Ga0105245_103120282 191
72 3300025909 Ga0207705_10082237 Ga0207705_100822373 191
73 3300026116 Ga0207674_10194172 Ga0207674_101941722 191
74 3300027866 Ga0209813_10031324 Ga0209813_100313242 191
75 3300028381 Ga0268264_10000208 Ga0268264_1000020813 191
76 3300028381 Ga0268264_10000272 Ga0268264_1000027225 191
77 3300031731 Ga0307405_10065751 Ga0307405_100657513 191
78 3300031995 Ga0307409_100095278 Ga0307409_1000952783 191
79 3300032002 Ga0307416_100008939 Ga0307416_1000089392 191
80 3300032002 Ga0307416_100039248 Ga0307416_1000392483 191
81 3300044683 Ga0466965_0066375 Ga0466965_0066375_96_740 191
82 3300044684 Ga0466966_0070263 Ga0466966_0070263_637_1281 191
83 3300044693 Ga0466961_0064838 Ga0466961_0064838_889_1533 191
84 3300044693 Ga0466961_0089041 Ga0466961_0089041_106_786 191
85 3300044694 Ga0466963_0024441 Ga0466963_0024441_2022_2666 191
86 3300044719 Ga0466971_0151342 Ga0466971_0151342_268_912 191
87 3300044735 Ga0466968_0167557 Ga0466968_0167557_200_844 191
88 3300044842 Ga0466957_0002895 Ga0466957_0002895_2976_3620 191
89 3300044842 Ga0466957_0109761 Ga0466957_0109761_1079_1723 191
90 3300045836 Ga0466958_0604766 Ga0466958_0604766_11_655 191
91 3300045976 Ga0466967_0434801 Ga0466967_0434801_357_1001 191
92 3300046499 Ga0495594_0081584 Ga0495594_0081584_1093_1698 191
93 3300048903 Ga0496100_0017184 Ga0496100_0017184_3244_3894 191
94 3300048904 Ga0496101_0000566 Ga0496101_0000566_13824_14474 191
95 3300048905 Ga0496102_0004608 Ga0496102_0004608_2086_2736 191
96 3300048905 Ga0496102_0511796 Ga0496102_0511796_410_1012 191
97 3300048906 Ga0496103_0001448 Ga0496103_0001448_5922_6572 191
98 3300048907 Ga0496104_0001552 Ga0496104_0001552_10697_11347 191
99 3300048907 Ga0496104_0635986 Ga0496104_0635986_263_880 191
100 3300048908 Ga0496105_0011705 Ga0496105_0011705_1535_2185 191
101 3300048908 Ga0496105_0035290 Ga0496105_0035290_3390_4007 191
102 3300048910 Ga0496107_0114160 Ga0496107_0114160_524_1174 191
103 3300048913 Ga0496110_0776001 Ga0496110_0776001_101_751 191
104 3300048913 Ga0496110_1001896 Ga0496110_1001896_74_685 191
105 3300048915 Ga0496112_0534553 Ga0496112_0534553_276_878 191
106 3300048917 Ga0496114_0004313 Ga0496114_0004313_6089_6739 191
107 3300048927 Ga0496124_0416073 Ga0496124_0416073_68_691 191
108 3300048929 Ga0496126_0682815 Ga0496126_0682815_51_653 191
109 3300049568 Ga0501031_0280954 Ga0501031_0280954_417_1028 191
110 3300049572 Ga0501036_0223231 Ga0501036_0223231_910_1521 191
111 3300049585 Ga0501069_0050785 Ga0501069_0050785_346_966 191
112 3300049589 Ga0501073_0347301 Ga0501073_0347301_84_704 191
113 3300049743 Ga0501081_0569300 Ga0501081_0569300_189_800 191
114 3300050490 nmdc:mga03n38_106626_c1 nmdc:mga03n38_106626_c1_632_1243 191
115 3300050490 nmdc:mga03n38_158147_c2 nmdc:mga03n38_158147_c2_150_761 191
116 3300050490 nmdc:mga03n38_191358_c1 nmdc:mga03n38_191358_c1_305_916 191
117 3300050491 nmdc:mga00v17_9609_c1 nmdc:mga00v17_9609_c1_3254_3865 191
118 3300050492 nmdc:mga0yw44_393262_c1 nmdc:mga0yw44_393262_c1_229_849 191
119 3300050492 nmdc:mga0yw44_43121_c1 nmdc:mga0yw44_43121_c1_605_1216 191
120 3300050494 nmdc:mga06z11_16922_c1 nmdc:mga06z11_16922_c1_2223_2834 191
121 3300050494 nmdc:mga06z11_201617_c1 nmdc:mga06z11_201617_c1_82_693 191
122 3300050495 nmdc:mga04h51_30904_c1 nmdc:mga04h51_30904_c1_214_825 191
123 3300061719 Ga0466962_0018584 Ga0466962_0018584_28_672 191
124 iso_pu_bacteria 2643221641 2644229332 191
125 iso_pu_bacteria 2643221711 2644607984 191
126 iso_pu_bacteria 2751185725 2753039706 191
127 iso_pu_bacteria 2751185792 2753328215 191
128 iso_pu_bacteria 2857481737 2857484904 191
129 iso_pu_bacteria 2974315732 2974315921 191
130 iso_pu_bacteria 2984523437 2984524084 191

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z69-assembly1.cif.gz_B structure of the recombination mediator protein recf-atprs in recfor pathway 0.7049 15 47
6d1t-assembly1.cif.gz_A complex of mbd1-mbd and methylated dna 0.6633 11 45
8fvi-assembly1.cif.gz_1 human apobec3h bound to hiv-1 vif in complex with cbf-beta, elob, eloc, and cul5 0.6414 5 50
5a8u-assembly1.cif.gz_A crystal structure of orgyia pseudotsugata cpv5 polyhedra 0.568 1 25
2b5t-assembly2.cif.gz_I 2.1 angstrom structure of a nonproductive complex between antithrombin, synthetic heparin mimetic sr123781 and two s195a thrombin molecules 0.5508 2 38
ID Description Score Start End Superfamily
af_Q94F00_84_227_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.7319 17 47 3.30.540.10
af_A5PM73_39_273_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.7121 17 47 3.40.570.10
af_A0A2R8RLX8_265_341_3.30.890.10 Alpha Beta;2-Layer Sandwich;Methyl-cpg-binding Protein 2; Chain A;Methyl-cpg-binding Protein 2; Chain A 0.6392 11 45 3.30.890.10
af_Q2FXL9_1_128_3.40.350.10 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.6184 29 71 3.40.350.10
af_B5DER2_2_107_2.60.40.4240 Mainly Beta;Sandwich;Immunoglobulin-like;Transcription activator, Churchill 0.6091 5 40 2.60.40.4240
ID Description Score Start End GO Terms
AF-A0A6B2VEZ5-F1-model_v4 Uncharacterized protein 0.9966 5 61
AF-A0A7X6HAH6-F1-model_v4 deleted 0.9804 5 68
AF-A0A2S5W595-F1-model_v4 DUF1905 domain-containing protein 0.9775 3 75
AF-A0A542UYV1-F1-model_v4 Uncharacterized protein 0.971 3 188
AF-A0A1S8C8G2-F1-model_v4 Uncharacterized protein 0.9709 1 75

Feature Viewer

pLDDT pTM Quality
86.77 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map