F146530

General Info

Members Datasets Scaffolds Average Seq Length
130 96 260 242

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0007612|Ga0466960_0007612_1875_2666
Length 263
Sequence VTDPATEPADPAGDPTPVRWQEYAAALFDLDGVVTPTAEVHMRAWSEMFNAFLSGWDGAGDTAEYTDADYFAHVDGKPRYDGVRDLLGSRGIALPEGTPDDPADADTVCGLGNRKNDAFNAVLARDGVTAYPGSVRLLDHLRELGLPLAVVSSSANAPAVLEAAGLLDRFATVVSGAVATRLGLRGKPAPDTFLHAAEELGAEAGSAVVLEDAVSGVRAGAAGGFGLVIGVDRGAGHDTLAAAGAGVVVSDLAELVPTDGPRR

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
4 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
15 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
21 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
22 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
23 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
24 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
25 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
26 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
27 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
28 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
29 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
30 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
31 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
32 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
33 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
34 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
35 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
36 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
37 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
44 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
45 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
46 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
47 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
48 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
49 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
50 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
53 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
54 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
55 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
56 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
67 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
68 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
69 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
70 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
71 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
76 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
77 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
78 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
79 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
80 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
81 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
82 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
83 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
84 2643221613 Oerskovia sp. Root22 Isolate Unclassified
85 2643221615 Nocardioides sp. Root224 Isolate Unclassified
86 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
87 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
88 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
89 2643221721 Oerskovia sp. Root918 Isolate Unclassified
90 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
91 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
92 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
93 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
94 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
95 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
96 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.54
Nodule 0
Rhizoplane 7.69
Rhizosphere 54.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0007612 3300044901 Bacteria 4409
2 rootL2_10173637 3300003322 Bacteria 7536
3 Ga0068852_100719776 3300005616 Bacteria 1009
4 Ga0081538_10011516 3300005981 Bacteria 7159
5 Ga0081539_10026956 3300005985 Bacteria 3650
6 Ga0075365_10001802 3300006038 Bacteria 9999
7 Ga0075365_10011288 3300006038 Bacteria 5247
8 Ga0075365_10059109 3300006038 Bacteria 2554
9 Ga0075365_10140760 3300006038 Bacteria 1675
10 Ga0075363_100020414 3300006048 Bacteria 3322
11 Ga0075363_100139415 3300006048 Bacteria 1364
12 Ga0075364_10024410 3300006051 Bacteria 3839
13 Ga0075364_10045439 3300006051 Bacteria 2858
14 Ga0075362_10033998 3300006177 Bacteria 2220
15 Ga0075367_10017276 3300006178 Bacteria 3957
16 Ga0075367_10032100 3300006178 Bacteria 3019
17 Ga0075370_10004728 3300006353 Bacteria 6655
18 Ga0075370_10187100 3300006353 Bacteria 1219
19 Ga0105243_10098839 3300009148 Bacteria 2418
20 Ga0157375_10052961 3300013308 Bacteria 3991
21 Ga0163163_10246061 3300014325 Bacteria 1838
22 Ga0157380_10031998 3300014326 Bacteria 4042
23 Ga0182008_10018527 3300014497 Bacteria 3605
24 Ga0207709_10129246 3300025935 Bacteria 1719
25 Ga0207669_10106639 3300025937 Bacteria 1867
26 Ga0207675_100520435 3300026118 Bacteria 1186
27 Ga0209813_10006839 3300027866 Bacteria 2827
28 Ga0316575_10000388 3300031665 Bacteria 12534
29 Ga0316575_10042279 3300031665 Bacteria 1805
30 Ga0316579_10006592 3300031691 Bacteria 4746
31 Ga0316576_10000304 3300031727 Bacteria 21773
32 Ga0316578_10007971 3300031728 Bacteria 5353
33 Ga0316578_10083415 3300031728 Bacteria 1903
34 Ga0316578_10115310 3300031728 Bacteria 1614
35 Ga0316577_10004251 3300031733 Bacteria 7365
36 Ga0307409_100192243 3300031995 Bacteria 1818
37 Ga0316574_0023239 3300035398 Bacteria 3700
38 Ga0316574_0313489 3300035398 Bacteria 996
39 Ga0316582_0001321 3300036647 Bacteria 10737
40 Ga0316582_0002373 3300036647 Bacteria 8830
41 Ga0316584_0001926 3300036712 Bacteria 12926
42 Ga0316584_0084233 3300036712 Bacteria 2381
43 Ga0395905_0006796 3300037471 Bacteria 11463
44 Ga0395901_0071122 3300038443 Bacteria 3625
45 Ga0400483_027223 3300039062 Bacteria 80217
46 Ga0400483_223286 3300039062 Bacteria 31435
47 Ga0439454_034342 3300042011 Bacteria 808
48 Ga0439455_0030579 3300042012 Bacteria 1337
49 Ga0450907_003506 3300042146 Bacteria 2792
50 Ga0439464_0004141 3300042439 Bacteria 3693
51 Ga0439440_0023411 3300042993 Bacteria 1408
52 Ga0466972_0029841 3300044658 Bacteria 2685
53 Ga0466965_0109737 3300044683 Bacteria 1417
54 Ga0466963_0177993 3300044694 Bacteria 1484
55 Ga0466970_0002666 3300044765 Bacteria 8613
56 Ga0466970_0005250 3300044765 Bacteria 6411
57 Ga0466970_0101218 3300044765 Bacteria 1569
58 Ga0466960_0018401 3300044901 Bacteria 3061
59 Ga0466960_0100291 3300044901 Bacteria 1490
60 Ga0466967_0030043 3300045976 Bacteria 4556
61 Ga0495582_0110256 3300046473 Bacteria 1546
62 Ga0496101_0666254 3300048904 Bacteria 822
63 Ga0496104_0015821 3300048907 Bacteria 6844
64 Ga0496104_0023612 3300048907 Bacteria 5655
65 Ga0496105_0245763 3300048908 Bacteria 1451
66 Ga0496109_0027725 3300048912 Bacteria 5060
67 Ga0496110_0034369 3300048913 Bacteria 4391
68 Ga0496110_0392429 3300048913 Bacteria 1265
69 Ga0496111_0031207 3300048914 Bacteria 3795
70 Ga0496114_0013744 3300048917 Bacteria 6489
71 Ga0496114_0419978 3300048917 Bacteria 1184
72 Ga0496118_0300205 3300048921 Bacteria 882
73 Ga0496122_0276161 3300048925 Bacteria 922
74 Ga0496123_0000275 3300048926 Bacteria 101770
75 Ga0496124_0001265 3300048927 Bacteria 38466
76 Ga0496124_0305131 3300048927 Bacteria 1147
77 Ga0496125_0184211 3300048928 Bacteria 1387
78 Ga0501033_0161989 3300049570 Bacteria 1610
79 Ga0501033_0191360 3300049570 Bacteria 1464
80 Ga0501034_0009127 3300049571 Bacteria 10411
81 Ga0501036_0049011 3300049572 Bacteria 3576
82 Ga0501038_0000864 3300049574 Bacteria 26869
83 Ga0501042_0016046 3300049578 Bacteria 5138
84 Ga0501042_0062380 3300049578 Bacteria 2663
85 Ga0501043_0140930 3300049579 Bacteria 1888
86 Ga0501046_0235178 3300049580 Bacteria 1353
87 Ga0501046_0244955 3300049580 Bacteria 1321
88 Ga0501047_0008299 3300049581 Bacteria 9803
89 Ga0501069_0314572 3300049585 Bacteria 919
90 Ga0501070_0562038 3300049586 Bacteria 912
91 Ga0501072_0099071 3300049588 Bacteria 2317
92 Ga0501073_0116639 3300049589 Bacteria 1850
93 Ga0501074_0132724 3300049590 Bacteria 1781
94 Ga0501079_0085289 3300049741 Bacteria 2444
95 Ga0501080_0546502 3300049742 Bacteria 1032
96 Ga0501083_0000178 3300049744 Bacteria 41100
97 Ga0501083_0002710 3300049744 Bacteria 12225
98 Ga0501035_0001566 3300049822 Bacteria 23270
99 Ga0501035_0157476 3300049822 Bacteria 1968
100 Ga0501044_0066465 3300049823 Bacteria 3676
101 Ga0501044_0407274 3300049823 Bacteria 1272
102 Ga0501044_0692950 3300049823 Bacteria 905
103 Ga0501045_0035150 3300049824 Bacteria 3638
104 nmdc:mga03n38_115698_c1 3300050490 Bacteria 1312
105 nmdc:mga03n38_17481_c1 3300050490 Bacteria 2810
106 nmdc:mga00v17_141177_c1 3300050491 Bacteria 1545
107 nmdc:mga00v17_23886_c1 3300050491 Bacteria 3541
108 nmdc:mga0yw44_185770_c1 3300050492 Bacteria 1370
109 nmdc:mga0yw44_34800_c1 3300050492 Bacteria 2954
110 nmdc:mga0yw44_6991_c1 3300050492 Bacteria 5515
111 nmdc:mga06z11_27585_c1 3300050494 Bacteria 2716
112 nmdc:mga07m45_39939_c1 3300050496 Bacteria 2625
113 nmdc:mga07m45_83279_c1 3300050496 Bacteria 1828
114 Ga0500644_0000271 3300053088 Bacteria 29196
115 Ga0500556_0001400 3300053104 Bacteria 10503
116 Ga0500593_000336 3300053117 Bacteria 18898
117 Ga0500573_0060479 3300053140 Bacteria 2169
118 2644083496 2643221613 Bacteria 4622396
119 2644090041 2643221615 Bacteria 5487866
120 2644319886 2643221657 Bacteria 5490246
121 2644455291 2643221681 Bacteria 3707866
122 2644539293 2643221697 Bacteria 3575694
123 2644664309 2643221721 Bacteria 4486924
124 2645721586 2643221961 Bacteria 3919167
125 2645724458 2643221962 Bacteria 3874254
126 2819426495 2818991318 Bacteria 5266538
127 2839986390 2839986021 Bacteria 3685650
128 2848551770 2848551377 Bacteria 3720646
129 2855387505 2855386786 Bacteria 4752232
130 2935892909 2935890801 Bacteria 4593001
131 Ga0466960_0007612
132 rootL2_10173637
133 Ga0068852_100719776
134 Ga0081538_10011516
135 Ga0081539_10026956
136 Ga0075365_10001802
137 Ga0075365_10011288
138 Ga0075365_10059109
139 Ga0075365_10140760
140 Ga0075363_100020414
141 Ga0075363_100139415
142 Ga0075364_10024410
143 Ga0075364_10045439
144 Ga0075362_10033998
145 Ga0075367_10017276
146 Ga0075367_10032100
147 Ga0075370_10004728
148 Ga0075370_10187100
149 Ga0105243_10098839
150 Ga0157375_10052961
151 Ga0163163_10246061
152 Ga0157380_10031998
153 Ga0182008_10018527
154 Ga0207709_10129246
155 Ga0207669_10106639
156 Ga0207675_100520435
157 Ga0209813_10006839
158 Ga0316575_10000388
159 Ga0316575_10042279
160 Ga0316579_10006592
161 Ga0316576_10000304
162 Ga0316578_10007971
163 Ga0316578_10083415
164 Ga0316578_10115310
165 Ga0316577_10004251
166 Ga0307409_100192243
167 Ga0316574_0023239
168 Ga0316574_0313489
169 Ga0316582_0001321
170 Ga0316582_0002373
171 Ga0316584_0001926
172 Ga0316584_0084233
173 Ga0395905_0006796
174 Ga0395901_0071122
175 Ga0400483_027223
176 Ga0400483_223286
177 Ga0439454_034342
178 Ga0439455_0030579
179 Ga0450907_003506
180 Ga0439464_0004141
181 Ga0439440_0023411
182 Ga0466972_0029841
183 Ga0466965_0109737
184 Ga0466963_0177993
185 Ga0466970_0002666
186 Ga0466970_0005250
187 Ga0466970_0101218
188 Ga0466960_0018401
189 Ga0466960_0100291
190 Ga0466967_0030043
191 Ga0495582_0110256
192 Ga0496101_0666254
193 Ga0496104_0015821
194 Ga0496104_0023612
195 Ga0496105_0245763
196 Ga0496109_0027725
197 Ga0496110_0034369
198 Ga0496110_0392429
199 Ga0496111_0031207
200 Ga0496114_0013744
201 Ga0496114_0419978
202 Ga0496118_0300205
203 Ga0496122_0276161
204 Ga0496123_0000275
205 Ga0496124_0001265
206 Ga0496124_0305131
207 Ga0496125_0184211
208 Ga0501033_0161989
209 Ga0501033_0191360
210 Ga0501034_0009127
211 Ga0501036_0049011
212 Ga0501038_0000864
213 Ga0501042_0016046
214 Ga0501042_0062380
215 Ga0501043_0140930
216 Ga0501046_0235178
217 Ga0501046_0244955
218 Ga0501047_0008299
219 Ga0501069_0314572
220 Ga0501070_0562038
221 Ga0501072_0099071
222 Ga0501073_0116639
223 Ga0501074_0132724
224 Ga0501079_0085289
225 Ga0501080_0546502
226 Ga0501083_0000178
227 Ga0501083_0002710
228 Ga0501035_0001566
229 Ga0501035_0157476
230 Ga0501044_0066465
231 Ga0501044_0407274
232 Ga0501044_0692950
233 Ga0501045_0035150
234 nmdc:mga03n38_115698_c1
235 nmdc:mga03n38_17481_c1
236 nmdc:mga00v17_141177_c1
237 nmdc:mga00v17_23886_c1
238 nmdc:mga0yw44_185770_c1
239 nmdc:mga0yw44_34800_c1
240 nmdc:mga0yw44_6991_c1
241 nmdc:mga06z11_27585_c1
242 nmdc:mga07m45_39939_c1
243 nmdc:mga07m45_83279_c1
244 Ga0500644_0000271
245 Ga0500556_0001400
246 Ga0500593_000336
247 Ga0500573_0060479
248 2644083496
249 2644090041
250 2644319886
251 2644455291
252 2644539293
253 2644664309
254 2645721586
255 2645724458
256 2819426495
257 2839986390
258 2848551770
259 2855387505
260 2935892909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

26

229

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

23

224

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.8848 122 240
6hdh-assembly1.cif.gz_A r49k variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer to 1.6 a. 0.8747 13 239
1lvh-assembly1.cif.gz_A the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution 0.8626 13 239
6h8y-assembly1.cif.gz_A t16a variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer complexed with aluminium tetrafluoride to 1.9 a. 0.8587 13 239
3kbb-assembly1.cif.gz_A crystal structure of putative beta-phosphoglucomutase from thermotoga maritima 0.8556 13 242
ID Description Score Start End Superfamily
4gibB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9297 118 241 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9262 118 240 3.40.50.1000
af_Q4CSI4_580_667_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9171 117 191 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9018 116 240 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8945 117 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A847MQ69-F1-model_v4 HAD family phosphatase 1.001 179 243 GO:0050308
AF-W4TRJ7-F1-model_v4 deleted 0.9869 135 242
AF-A0A847MQ69-F1-model_v4 HAD family phosphatase 0.9862 179 243 GO:0050308
AF-A0A7W0XX59-F1-model_v4 HAD family phosphatase 0.9774 169 244 GO:0050308
AF-A0A7C2IWM3-F1-model_v4 deleted 0.977 117 238

Map