F146162

General Info

Members Datasets Scaffolds Average Seq Length
130 83 103 161

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10088266|Ga0307510_100882662
Length 188
Sequence MIGNDVVDLIQSRHESNWQRKGFIEKLFTAEEQLLIKHDSNPEIMVWLLWSMKEAAYKIYNRQTKLRQYIPKKLICNIVSNNNNCITGQVTCCENVYHTKTTIFTDSIHTIAVSFLHDLNNVIEIENTGIIKDQYGIPYLNTLQNRIKDVSITHHGRFEKVVTIIKKNNRQNQQDSVLDNIKFHCTNL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541284 Pedobacter sp. YR016 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2739367651 Pedobacter sp. OK291 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
15 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
16 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
19 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
20 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
21 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
22 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
23 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
24 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
25 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
26 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
63 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
69 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
70 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
71 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
72 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
73 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
74 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
75 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
76 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
77 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
78 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
79 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
80 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
81 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
82 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
83 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.23
Metatranscriptomes 0
Isolates 20.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 1.54
Rhizoplane 0.77
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 17.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1463173 2162886007 Bacteria 8874
2 SwRhRL2b_contig_204006 2162886007 Bacteria 919
3 rootH1_10368997 3300003323 Bacteria 1922
4 Ga0065714_10002785 3300005288 Bacteria 18311
5 Ga0065714_10004953 3300005288 Bacteria 10985
6 Ga0065714_10007238 3300005288 Bacteria 7198
7 Ga0065714_10011419 3300005288 Bacteria 2929
8 Ga0065714_10015211 3300005288 Bacteria 1832
9 Ga0065704_10000251 3300005289 Bacteria 69899
10 Ga0065704_10076259 3300005289 Bacteria 5200
11 Ga0065704_10186540 3300005289 Unclassified 1210
12 Ga0070682_100059842 3300005337 Bacteria 2407
13 Ga0068852_100465901 3300005616 Bacteria 1253
14 Ga0079104_1000139 3300006946 Bacteria 102950
15 Ga0105251_10331469 3300009011 Bacteria 692
16 Ga0105250_10099562 3300009092 Bacteria 1186
17 Ga0157373_10000296 3300013100 Bacteria 40219
18 Ga0157373_10009418 3300013100 Bacteria 7213
19 Ga0157373_10047978 3300013100 Bacteria 3045
20 Ga0157373_10208804 3300013100 Bacteria 1377
21 Ga0157373_10916057 3300013100 Bacteria 651
22 Ga0157371_10000041 3300013102 Bacteria 203957
23 Ga0157371_10000697 3300013102 Bacteria 39526
24 Ga0157371_10001043 3300013102 Bacteria 30400
25 Ga0157371_10006115 3300013102 Bacteria 10007
26 Ga0157370_10000043 3300013104 Bacteria 132770
27 Ga0157370_10000195 3300013104 Bacteria 76072
28 Ga0157370_10001249 3300013104 Bacteria 31757
29 Ga0157370_10027674 3300013104 Bacteria 5589
30 Ga0157370_10243174 3300013104 Bacteria 1665
31 Ga0157370_10270095 3300013104 Bacteria 1571
32 Ga0157369_10000016 3300013105 Bacteria 257827
33 Ga0157369_10001214 3300013105 Bacteria 32084
34 Ga0163162_10000813 3300013306 Bacteria 28949
35 Ga0163162_10052413 3300013306 Bacteria 4098
36 Ga0182008_10000010 3300014497 Bacteria 301527
37 Ga0182006_1001062 3300015261 Bacteria 17672
38 Ga0182006_1003953 3300015261 Bacteria 7413
39 Ga0182006_1021660 3300015261 Bacteria 2678
40 Ga0182007_10000002 3300015262 Bacteria 564661
41 Ga0183373_1004 3300015682 Bacteria 537398
42 Ga0163161_10000026 3300017792 Bacteria 199745
43 Ga0163161_10000593 3300017792 Bacteria 29004
44 Ga0163161_10001199 3300017792 Bacteria 19518
45 Ga0207696_1100898 3300025711 Bacteria 786
46 Ga0209281_1000351 3300027111 Bacteria 75878
47 Ga0307515_10415375 3300028794 Bacteria 967
48 Ga0316181_1080040 3300030744 Bacteria 3114
49 Ga0307513_10230754 3300031456 Bacteria 1664
50 Ga0307408_100007659 3300031548 Bacteria 7142
51 Ga0307405_10000006 3300031731 Bacteria 361477
52 Ga0307413_10000748 3300031824 Bacteria 11212
53 Ga0307410_10000028 3300031852 Bacteria 50901
54 Ga0307406_10000153 3300031901 Bacteria 41029
55 Ga0307407_10000003 3300031903 Bacteria 271723
56 Ga0307407_10613491 3300031903 Bacteria 811
57 Ga0307412_10000009 3300031911 Bacteria 445987
58 Ga0307409_100004918 3300031995 Bacteria 7605
59 Ga0307416_100000002 3300032002 Bacteria 509907
60 Ga0307414_10000002 3300032004 Bacteria 623006
61 Ga0307414_10004727 3300032004 Bacteria 7430
62 Ga0307414_10012369 3300032004 Bacteria 5043
63 Ga0307414_10015600 3300032004 Bacteria 4588
64 Ga0307414_10050485 3300032004 Bacteria 2882
65 Ga0307414_10050737 3300032004 Bacteria 2876
66 Ga0307414_10154153 3300032004 Bacteria 1816
67 Ga0307414_10183728 3300032004 Bacteria 1684
68 Ga0307414_10634613 3300032004 Bacteria 961
69 Ga0307414_10803153 3300032004 Bacteria 858
70 Ga0307414_10910770 3300032004 Bacteria 806
71 Ga0307414_11113228 3300032004 Bacteria 729
72 Ga0307411_10000001 3300032005 Bacteria 931810
73 Ga0307411_10862684 3300032005 Unclassified 802
74 Ga0307510_10088266 3300033180 Bacteria 2961
75 Ga0439466_0000701 3300041411 Bacteria 12658
76 Ga0451797_1186905 3300041453 Bacteria 866
77 Ga0495627_097957 3300046453 Bacteria 839
78 Ga0495606_0033346 3300046507 Bacteria 3552
79 Ga0495606_0248447 3300046507 Bacteria 988
80 Ga0495616_0128896 3300046513 Bacteria 1161
81 Ga0495643_0000970 3300046522 Bacteria 29411
82 Ga0495625_0061141 3300046660 Bacteria 2666
83 Ga0496121_0017736 3300048924 Bacteria 7243
84 Ga0501224_028949 3300049664 Bacteria 829
85 Ga0501238_000148 3300049671 Bacteria 10810
86 Ga0501249_000004 3300049679 Bacteria 226777
87 Ga0501249_029630 3300049679 Bacteria 1217
88 Ga0501249_047387 3300049679 Bacteria 983
89 Ga0501241_003317 3300049758 Bacteria 3043
90 Ga0501241_005986 3300049758 Bacteria 2255
91 Ga0501241_007610 3300049758 Bacteria 1984
92 Ga0501241_032183 3300049758 Bacteria 994
93 Ga0501266_000014 3300049763 Bacteria 181600
94 Ga0501266_002966 3300049763 Bacteria 2114
95 Ga0500644_0087167 3300053088 Bacteria 1161
96 Ga0500651_0000528 3300053093 Bacteria 19528
97 Ga0500641_0000007 3300053096 Bacteria 206510
98 Ga0500641_0000051 3300053096 Bacteria 53081
99 Ga0500641_0000366 3300053096 Bacteria 16777
100 Ga0500658_0000003 3300053134 Bacteria 512506
101 Ga0500559_0119613 3300053136 Bacteria 1224
102 Ga0500589_134841 3300053147 Bacteria 1026
103 Ga0500584_003408 3300053726 Bacteria 6292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10007238 Ga0065714_100072383 121
2 3300006946 Ga0079104_1000139 Ga0079104_100013936 130
3 3300027111 Ga0209281_1000351 Ga0209281_100035132 130
4 iso_pu_bacteria 2585427687 2586207758 133
5 iso_pu_bacteria 2739367651 2739588006 133
6 iso_pu_bacteria 2842722452 2842724215 133
7 iso_pu_bacteria 2849281842 2849282527 133
8 iso_pu_bacteria 2945997725 2945998961 133
9 3300031456 Ga0307513_10230754 Ga0307513_102307543 134
10 3300053096 Ga0500641_0000051 Ga0500641_0000051_30239_30727 134
11 iso_pu_bacteria 2513020052 2513233553 134
12 iso_pu_bacteria 2643221725 2644682854 134
13 iso_pu_bacteria 2802428842 2802654531 134
14 iso_pu_bacteria 2904555929 2904560040 134
15 iso_pu_bacteria 2954016120 2954021413 134
16 iso_pu_bacteria 2977268062 2977270550 134
17 iso_pu_bacteria 8055592153 8055592839 134
18 iso_pu_bacteria 2643221667 2644372776 135
19 iso_pu_bacteria 2643221716 2644644397 135
20 iso_pu_bacteria 2738541279 2738732234 135
21 iso_pu_bacteria 2738541284 2738760694 135
22 iso_pu_bacteria 2738541285 2738764799 135
23 iso_pu_bacteria 2738543007 2739213814 135
24 iso_pu_bacteria 2739367857 2740001952 135
25 iso_pu_bacteria 2739367858 2740006768 135
26 iso_pu_bacteria 2775506987 2776612897 135
27 iso_pu_bacteria 2857613821 2857617440 135
28 iso_pu_bacteria 2857618242 2857618862 135
29 iso_pu_bacteria 2904419702 2904420645 135
30 iso_pu_bacteria 2919683626 2919686703 135
31 iso_pu_bacteria 2929150217 2929152313 135
32 iso_pu_bacteria 8055419101 8055423746 135
33 3300031731 Ga0307405_10000006 Ga0307405_10000006128 136
34 3300005288 Ga0065714_10011419 Ga0065714_100114192 137
35 3300005288 Ga0065714_10015211 Ga0065714_100152112 137
36 3300005616 Ga0068852_100465901 Ga0068852_1004659011 137
37 3300013100 Ga0157373_10047978 Ga0157373_100479785 137
38 3300013100 Ga0157373_10916057 Ga0157373_109160571 137
39 3300013102 Ga0157371_10000041 Ga0157371_1000004155 137
40 3300013104 Ga0157370_10027674 Ga0157370_100276742 137
41 3300013104 Ga0157370_10243174 Ga0157370_102431742 137
42 3300013105 Ga0157369_10000016 Ga0157369_10000016175 137
43 3300013306 Ga0163162_10000813 Ga0163162_100008139 137
44 3300015261 Ga0182006_1001062 Ga0182006_10010629 137
45 3300015262 Ga0182007_10000002 Ga0182007_10000002373 137
46 3300015682 Ga0183373_1004 Ga0183373_1004112 137
47 3300017792 Ga0163161_10000593 Ga0163161_1000059315 137
48 3300017792 Ga0163161_10001199 Ga0163161_1000119918 137
49 3300031903 Ga0307407_10000003 Ga0307407_10000003116 137
50 3300031995 Ga0307409_100004918 Ga0307409_1000049183 137
51 3300032002 Ga0307416_100000002 Ga0307416_100000002362 137
52 3300032004 Ga0307414_10154153 Ga0307414_101541533 137
53 3300046453 Ga0495627_097957 Ga0495627_097957_30_494 137
54 3300046507 Ga0495606_0033346 Ga0495606_0033346_2159_2623 137
55 3300049679 Ga0501249_029630 Ga0501249_029630_378_842 137
56 3300013104 Ga0157370_10000043 Ga0157370_1000004337 138
57 3300013104 Ga0157370_10000195 Ga0157370_1000019512 138
58 3300013104 Ga0157370_10270095 Ga0157370_102700953 138
59 3300013306 Ga0163162_10052413 Ga0163162_100524132 138
60 3300015261 Ga0182006_1003953 Ga0182006_10039535 138
61 3300028794 Ga0307515_10415375 Ga0307515_104153752 138
62 3300030744 Ga0316181_1080040 Ga0316181_10800403 138
63 3300032004 Ga0307414_10004727 Ga0307414_100047278 138
64 3300032004 Ga0307414_10012369 Ga0307414_100123693 138
65 3300032004 Ga0307414_10183728 Ga0307414_101837282 138
66 3300033180 Ga0307510_10088266 Ga0307510_100882662 138
67 3300041411 Ga0439466_0000701 Ga0439466_0000701_6503_7003 138
68 3300049758 Ga0501241_032183 Ga0501241_032183_314_775 138
69 3300053096 Ga0500641_0000366 Ga0500641_0000366_9897_10400 138
70 3300053147 Ga0500589_134841 Ga0500589_134841_167_733 138
71 2162886007 SwRhRL2b_contig_1463173 SwRhRL2b_0051.00003880 139
72 2162886007 SwRhRL2b_contig_204006 SwRhRL2b_0624.00003840 139
73 3300003323 rootH1_10368997 rootH1_103689972 139
74 3300005288 Ga0065714_10002785 Ga0065714_1000278514 139
75 3300005288 Ga0065714_10004953 Ga0065714_100049539 139
76 3300005289 Ga0065704_10000251 Ga0065704_1000025153 139
77 3300005289 Ga0065704_10076259 Ga0065704_100762593 139
78 3300005289 Ga0065704_10186540 Ga0065704_101865402 139
79 3300005337 Ga0070682_100059842 Ga0070682_1000598424 139
80 3300009011 Ga0105251_10331469 Ga0105251_103314692 139
81 3300009092 Ga0105250_10099562 Ga0105250_100995622 139
82 3300013100 Ga0157373_10000296 Ga0157373_1000029624 139
83 3300013100 Ga0157373_10009418 Ga0157373_100094183 139
84 3300013100 Ga0157373_10208804 Ga0157373_102088041 139
85 3300013102 Ga0157371_10000697 Ga0157371_1000069720 139
86 3300013102 Ga0157371_10001043 Ga0157371_1000104315 139
87 3300013102 Ga0157371_10006115 Ga0157371_100061152 139
88 3300013104 Ga0157370_10001249 Ga0157370_1000124918 139
89 3300013105 Ga0157369_10001214 Ga0157369_1000121414 139
90 3300014497 Ga0182008_10000010 Ga0182008_1000001015 139
91 3300015261 Ga0182006_1021660 Ga0182006_10216603 139
92 3300017792 Ga0163161_10000026 Ga0163161_10000026159 139
93 3300025711 Ga0207696_1100898 Ga0207696_11008982 139
94 3300031548 Ga0307408_100007659 Ga0307408_1000076592 139
95 3300031824 Ga0307413_10000748 Ga0307413_100007486 139
96 3300031852 Ga0307410_10000028 Ga0307410_1000002843 139
97 3300031901 Ga0307406_10000153 Ga0307406_1000015328 139
98 3300031903 Ga0307407_10613491 Ga0307407_106134912 139
99 3300031911 Ga0307412_10000009 Ga0307412_10000009244 139
100 3300032004 Ga0307414_10000002 Ga0307414_1000000235 139
101 3300032004 Ga0307414_10015600 Ga0307414_100156003 139
102 3300032004 Ga0307414_10050485 Ga0307414_100504852 139
103 3300032004 Ga0307414_10050737 Ga0307414_100507373 139
104 3300032004 Ga0307414_10634613 Ga0307414_106346132 139
105 3300032004 Ga0307414_10803153 Ga0307414_108031532 139
106 3300032004 Ga0307414_10910770 Ga0307414_109107702 139
107 3300032004 Ga0307414_11113228 Ga0307414_111132282 139
108 3300032005 Ga0307411_10000001 Ga0307411_1000000149 139
109 3300032005 Ga0307411_10862684 Ga0307411_108626842 139
110 3300041453 Ga0451797_1186905 Ga0451797_1186905_123_623 139
111 3300046507 Ga0495606_0248447 Ga0495606_0248447_63_563 139
112 3300046513 Ga0495616_0128896 Ga0495616_0128896_642_1151 139
113 3300046522 Ga0495643_0000970 Ga0495643_0000970_5265_5774 139
114 3300046660 Ga0495625_0061141 Ga0495625_0061141_1318_1833 139
115 3300048924 Ga0496121_0017736 Ga0496121_0017736_1778_2287 139
116 3300049664 Ga0501224_028949 Ga0501224_028949_208_714 139
117 3300049671 Ga0501238_000148 Ga0501238_000148_2777_3283 139
118 3300049679 Ga0501249_000004 Ga0501249_000004_25530_26039 139
119 3300049679 Ga0501249_047387 Ga0501249_047387_200_706 139
120 3300049758 Ga0501241_003317 Ga0501241_003317_2035_2499 139
121 3300049758 Ga0501241_005986 Ga0501241_005986_504_1010 139
122 3300049758 Ga0501241_007610 Ga0501241_007610_696_1211 139
123 3300049763 Ga0501266_000014 Ga0501266_000014_7549_8064 139
124 3300049763 Ga0501266_002966 Ga0501266_002966_1493_1999 139
125 3300053088 Ga0500644_0087167 Ga0500644_0087167_138_656 139
126 3300053093 Ga0500651_0000528 Ga0500651_0000528_17602_18066 139
127 3300053096 Ga0500641_0000007 Ga0500641_0000007_192229_192747 139
128 3300053134 Ga0500658_0000003 Ga0500658_0000003_403227_403739 139
129 3300053136 Ga0500559_0119613 Ga0500559_0119613_208_711 139
130 3300053726 Ga0500584_003408 Ga0500584_003408_4340_4873 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

1

115

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zvp-assembly1.cif.gz_A crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein 0.7754 107 138
1zvp-assembly2.cif.gz_B crystal structure of a protein of unknown function vc0802 from vibrio cholerae, possible transport protein 0.7732 107 138
3s6g-assembly1.cif.gz_A crystal structures of seleno-substituted mutant mmnags in space group p212121 0.6815 103 138
2was-assembly2.cif.gz_F structure of the fungal type i fas ppt domain 0.507 14 137
2wat-assembly2.cif.gz_F structure of the fungal type i fas ppt domain in complex with coa 0.5029 14 137
ID Description Score Start End Superfamily
1zvpB00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7732 107 138 3.30.2130.10
af_Q23353_103_173_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.556 102 138 3.90.1150.10
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.4805 7 137 3.90.470.20
4fxgC01 Mainly Beta;Sandwich;Immunoglobulin-like;Alpha-macroglobulin, receptor-binding domain 0.4693 107 138 2.60.40.690
af_Q8BZ10_44_151_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.4512 24 106 3.30.70.960
ID Description Score Start End GO Terms
AF-A0A520I712-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.8983 1 52 GO:0000287
GO:0008897
AF-A0A520I712-F1-model_v4 4'-phosphopantetheinyl transferase superfamily protein 0.8664 1 52 GO:0000287
GO:0008897
AF-A0A4Q3UAR7-F1-model_v4 4-phosphopantetheinyl transferase family protein 0.7076 7 137 GO:0000287
GO:0008897
AF-A0A519V7L0-F1-model_v4 4-phosphopantetheinyl transferase family protein 0.6129 7 137 GO:0000287
GO:0008897
AF-A0A354DAD8-F1-model_v4 deleted 0.6087 1 135

Feature Viewer

pLDDT pTM Quality
77.42 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map