F146014

General Info

Members Datasets Scaffolds Average Seq Length
130 106 127 132

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001140|Ga0265327_1000114021
Length 137
Sequence MKDLSIRLENRPGSLATLGETLGRAGVSIEGGGAWVVGATGQAHFLVADGEADRARAALADAGLAVSAVRDVVVQKLRQGEPGQLGKLTRRMADAGVNIEVLYSDHANQLVLVVDDPARGRAVADAWMRERAGKAVS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
65 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
104 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
105 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
106 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.08
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1253721 2162886012 Bacteria 1224
2 rootH1_10168062 3300003316 Bacteria 2551
3 rootL2_10225994 3300003322 Bacteria 6187
4 Ga0070676_10237259 3300005328 Bacteria 1211
5 Ga0068869_101366368 3300005334 Unclassified 626
6 Ga0070689_100303389 3300005340 Bacteria 1330
7 Ga0070687_100014614 3300005343 Bacteria 3530
8 Ga0070687_100359312 3300005343 Unclassified 942
9 Ga0070674_100945019 3300005356 Unclassified 753
10 Ga0070708_100049192 3300005445 Bacteria 3729
11 Ga0070708_101905542 3300005445 Unclassified 551
12 Ga0070685_10041625 3300005466 Bacteria 2619
13 Ga0070706_100170883 3300005467 Bacteria 2030
14 Ga0070707_100004939 3300005468 Bacteria 12494
15 Ga0070707_100080701 3300005468 Unclassified 3140
16 Ga0070699_100110444 3300005518 Bacteria 2414
17 Ga0070684_100116881 3300005535 Unclassified 2396
18 Ga0070697_100183972 3300005536 Bacteria 1772
19 Ga0070697_101136337 3300005536 Unclassified 695
20 Ga0070686_100241036 3300005544 Bacteria 1317
21 Ga0070695_101140154 3300005545 Bacteria 639
22 Ga0070696_100648020 3300005546 Unclassified 856
23 Ga0070704_100350726 3300005549 Bacteria 1246
24 Ga0070702_100454589 3300005615 Bacteria 930
25 Ga0068859_100124577 3300005617 Bacteria 2645
26 Ga0068859_101796720 3300005617 Bacteria 677
27 Ga0068858_101128090 3300005842 Bacteria 770
28 Ga0068862_100447352 3300005844 Bacteria 1217
29 Ga0081455_10459538 3300005937 Unclassified 867
30 Ga0070717_10000021 3300006028 Bacteria 162915
31 Ga0075428_100355419 3300006844 Bacteria 1572
32 Ga0075431_100042772 3300006847 Bacteria 4674
33 Ga0075433_10223844 3300006852 Bacteria 1671
34 Ga0075433_10237854 3300006852 Unclassified 1617
35 Ga0075434_100087993 3300006871 Bacteria 3107
36 Ga0075434_100197407 3300006871 Bacteria 2032
37 Ga0097620_100124575 3300006931 Bacteria 2645
38 Ga0097620_101795873 3300006931 Bacteria 677
39 Ga0075435_101686979 3300007076 Unclassified 556
40 Ga0111539_10561539 3300009094 Bacteria 1329
41 Ga0114129_10123519 3300009147 Bacteria 3560
42 Ga0157378_11129607 3300013297 Bacteria 821
43 Ga0157377_10216395 3300014745 Bacteria 1224
44 Ga0157376_10142734 3300014969 Unclassified 2150
45 Ga0157376_12630263 3300014969 Bacteria 543
46 Ga0163161_12006800 3300017792 Unclassified 515
47 Ga0207684_10169384 3300025910 Bacteria 1883
48 Ga0207707_10155304 3300025912 Bacteria 2001
49 Ga0207693_10376334 3300025915 Unclassified 1111
50 Ga0207660_10199029 3300025917 Bacteria 1564
51 Ga0207662_10307227 3300025918 Unclassified 1056
52 Ga0207652_10161846 3300025921 Bacteria 2006
53 Ga0207646_10002998 3300025922 Bacteria 19494
54 Ga0207686_10055058 3300025934 Bacteria 2494
55 Ga0207661_10832287 3300025944 Unclassified 850
56 Ga0207658_10633421 3300025986 Bacteria 963
57 Ga0207703_10085287 3300026035 Unclassified 2643
58 Ga0207674_11253843 3300026116 Unclassified 711
59 Ga0207674_11811691 3300026116 Unclassified 577
60 Ga0207675_100784587 3300026118 Unclassified 965
61 Ga0265323_10083350 3300028653 Bacteria 1078
62 Ga0265327_10001140 3300031251 Bacteria 36351
63 Ga0307413_10077548 3300031824 Bacteria 2116
64 Ga0307410_10022268 3300031852 Bacteria 3913
65 Ga0307410_10584792 3300031852 Unclassified 929
66 Ga0307406_10387014 3300031901 Unclassified 1104
67 Ga0307407_10023763 3300031903 Bacteria 3203
68 Ga0307407_10256260 3300031903 Unclassified 1201
69 Ga0307409_100039142 3300031995 Bacteria 3515
70 Ga0307409_100101224 3300031995 Bacteria 2390
71 Ga0307416_100246898 3300032002 Bacteria 1734
72 Ga0307414_10091485 3300032004 Bacteria 2261
73 Ga0307414_11356240 3300032004 Bacteria 660
74 Ga0307411_10020218 3300032005 Bacteria 3867
75 Ga0307411_10110964 3300032005 Bacteria 1962
76 Ga0307415_100369902 3300032126 Unclassified 1213
77 Ga0307415_100633929 3300032126 Bacteria 956
78 Ga0373928_0193765 3300035084 Bacteria 583
79 Ga0373929_0086170 3300035085 Bacteria 773
80 Ga0373940_0124333 3300035088 Bacteria 803
81 Ga0373940_0195330 3300035088 Bacteria 663
82 Ga0373932_0001134 3300035112 Bacteria 7673
83 Ga0373941_0147544 3300035115 Bacteria 860
84 Ga0373960_0065452 3300035121 Bacteria 1112
85 Ga0373931_0224773 3300035691 Bacteria 1132
86 Ga0373937_1171881 3300036401 Bacteria 717
87 Ga0373925_0180018 3300037068 Bacteria 1673
88 Ga0395905_0054172 3300037471 Bacteria 3754
89 Ga0451804_1160486 3300041463 Unclassified 684
90 Ga0451577_0835610 3300042876 Unclassified 831
91 Ga0466966_0116471 3300044684 Bacteria 1645
92 Ga0451576_2489798 3300045051 Unclassified 529
93 Ga0495580_0213157 3300046472 Bacteria 1328
94 Ga0495580_0670756 3300046472 Unclassified 680
95 Ga0495580_0807264 3300046472 Unclassified 608
96 Ga0495643_0000003 3300046522 Bacteria 571962
97 Ga0495587_0636635 3300046536 Unclassified 586
98 Ga0495635_0166255 3300046663 Unclassified 1501
99 Ga0495647_0030525 3300046681 Bacteria 2000
100 Ga0495660_0311275 3300046810 Bacteria 710
101 Ga0495674_0221902 3300047319 Unclassified 1562
102 Ga0495674_1425384 3300047319 Bacteria 515
103 Ga0496104_0663824 3300048907 Unclassified 951
104 Ga0496112_0297232 3300048915 Unclassified 1560
105 Ga0496113_0246647 3300048916 Bacteria 1425
106 Ga0496124_0280176 3300048927 Bacteria 1216
107 Ga0501033_0272053 3300049570 Bacteria 1197
108 Ga0501038_0275462 3300049574 Bacteria 1326
109 Ga0501040_0902980 3300049576 Bacteria 640
110 Ga0501043_0312642 3300049579 Bacteria 1199
111 Ga0501072_0427810 3300049588 Bacteria 1049
112 Ga0501074_1294474 3300049590 Bacteria 511
113 Ga0501080_1124002 3300049742 Unclassified 678
114 Ga0501044_0579746 3300049823 Bacteria 1016
115 nmdc:mga05p37_321327_c1 3300050507 Bacteria 1832
116 nmdc:mga09592_526129_c1 3300050508 Bacteria 1017
117 nmdc:mga0qj67_815750_c1 3300050509 Unclassified 738
118 nmdc:mga06r32_1306977_c1 3300050510 Unclassified 669
119 nmdc:mga0n895_167478_c1 3300050512 Bacteria 2229
120 nmdc:mga0n895_199225_c1 3300050512 Unclassified 2034
121 nmdc:mga0rr50_38690_c1 3300050513 Bacteria 3454
122 nmdc:mga0rr50_511103_c1 3300050513 Bacteria 1022
123 nmdc:mga08x19_345479_c1 3300050514 Bacteria 1038
124 nmdc:mga0a205_1123926_c1 3300050515 Bacteria 633
125 nmdc:mga0a205_283224_c1 3300050515 Bacteria 1533
126 nmdc:mga0a205_298782_c1 3300050515 Unclassified 1483
127 Ga0495619_0421886 3300053085 Unclassified 920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10077548 Ga0307413_100775483 108
2 3300031852 Ga0307410_10022268 Ga0307410_100222684 108
3 3300031903 Ga0307407_10023763 Ga0307407_100237634 108
4 3300031995 Ga0307409_100039142 Ga0307409_1000391422 108
5 3300032004 Ga0307414_11356240 Ga0307414_113562402 108
6 3300032005 Ga0307411_10110964 Ga0307411_101109643 108
7 3300032126 Ga0307415_100633929 Ga0307415_1006339292 108
8 3300028653 Ga0265323_10083350 Ga0265323_100833502 110
9 3300013297 Ga0157378_11129607 Ga0157378_111296072 114
10 3300047319 Ga0495674_1425384 Ga0495674_1425384_32_391 114
11 3300035084 Ga0373928_0193765 Ga0373928_0193765_38_388 116
12 3300005544 Ga0070686_100241036 Ga0070686_1002410362 117
13 3300005545 Ga0070695_101140154 Ga0070695_1011401541 117
14 3300035112 Ga0373932_0001134 Ga0373932_0001134_1815_2168 117
15 3300035115 Ga0373941_0147544 Ga0373941_0147544_352_723 123
16 3300050513 nmdc:mga0rr50_38690_c1 nmdc:mga0rr50_38690_c1_81_452 123
17 3300005546 Ga0070696_100648020 Ga0070696_1006480202 125
18 3300042876 Ga0451577_0835610 Ga0451577_0835610_145_573 125
19 3300005328 Ga0070676_10237259 Ga0070676_102372592 127
20 3300005334 Ga0068869_101366368 Ga0068869_1013663682 127
21 3300005340 Ga0070689_100303389 Ga0070689_1003033893 127
22 3300005468 Ga0070707_100080701 Ga0070707_1000807012 127
23 3300005535 Ga0070684_100116881 Ga0070684_1001168812 127
24 3300005615 Ga0070702_100454589 Ga0070702_1004545892 127
25 3300049574 Ga0501038_0275462 Ga0501038_0275462_730_1113 127
26 3300049742 Ga0501080_1124002 Ga0501080_1124002_100_483 127
27 3300049823 Ga0501044_0579746 Ga0501044_0579746_619_1002 127
28 iso_pu_bacteria 8021622325 8021624305 127
29 iso_pu_bacteria 8021626552 8021628210 127
30 iso_pu_bacteria 8021648035 8021651467 127
31 3300007076 Ga0075435_101686979 Ga0075435_1016869792 128
32 3300036401 Ga0373937_1171881 Ga0373937_1171881_290_676 128
33 3300005356 Ga0070674_100945019 Ga0070674_1009450192 129
34 3300005445 Ga0070708_101905542 Ga0070708_1019055421 129
35 3300005466 Ga0070685_10041625 Ga0070685_100416255 129
36 3300014745 Ga0157377_10216395 Ga0157377_102163952 129
37 3300014969 Ga0157376_12630263 Ga0157376_126302631 129
38 3300017792 Ga0163161_12006800 Ga0163161_120068001 129
39 3300025934 Ga0207686_10055058 Ga0207686_100550584 129
40 3300025986 Ga0207658_10633421 Ga0207658_106334212 129
41 3300026118 Ga0207675_100784587 Ga0207675_1007845872 129
42 3300035088 Ga0373940_0124333 Ga0373940_0124333_353_757 129
43 3300046472 Ga0495580_0213157 Ga0495580_0213157_54_443 129
44 3300046472 Ga0495580_0807264 Ga0495580_0807264_193_582 129
45 3300046536 Ga0495587_0636635 Ga0495587_0636635_177_566 129
46 3300046681 Ga0495647_0030525 Ga0495647_0030525_1361_1750 129
47 3300053085 Ga0495619_0421886 Ga0495619_0421886_328_717 129
48 3300005343 Ga0070687_100014614 Ga0070687_1000146143 130
49 3300005343 Ga0070687_100359312 Ga0070687_1003593122 130
50 3300005536 Ga0070697_100183972 Ga0070697_1001839722 130
51 3300025918 Ga0207662_10307227 Ga0207662_103072272 130
52 3300031852 Ga0307410_10584792 Ga0307410_105847922 130
53 3300031901 Ga0307406_10387014 Ga0307406_103870142 130
54 3300031903 Ga0307407_10256260 Ga0307407_102562603 130
55 3300031995 Ga0307409_100101224 Ga0307409_1001012243 130
56 3300032002 Ga0307416_100246898 Ga0307416_1002468983 130
57 3300032004 Ga0307414_10091485 Ga0307414_100914852 130
58 3300032005 Ga0307411_10020218 Ga0307411_100202186 130
59 3300032126 Ga0307415_100369902 Ga0307415_1003699022 130
60 3300037471 Ga0395905_0054172 Ga0395905_0054172_2696_3088 130
61 3300047319 Ga0495674_0221902 Ga0495674_0221902_1057_1449 130
62 3300050508 nmdc:mga09592_526129_c1 nmdc:mga09592_526129_c1_180_572 130
63 3300050509 nmdc:mga0qj67_815750_c1 nmdc:mga0qj67_815750_c1_271_678 130
64 3300050510 nmdc:mga06r32_1306977_c1 nmdc:mga06r32_1306977_c1_67_459 130
65 3300050515 nmdc:mga0a205_298782_c1 nmdc:mga0a205_298782_c1_354_746 130
66 3300003316 rootH1_10168062 rootH1_101680623 131
67 3300003322 rootL2_10225994 rootL2_102259943 131
68 3300005445 Ga0070708_100049192 Ga0070708_1000491922 131
69 3300005549 Ga0070704_100350726 Ga0070704_1003507262 131
70 3300005617 Ga0068859_100124577 Ga0068859_1001245774 131
71 3300005617 Ga0068859_101796720 Ga0068859_1017967201 131
72 3300005842 Ga0068858_101128090 Ga0068858_1011280902 131
73 3300005844 Ga0068862_100447352 Ga0068862_1004473523 131
74 3300006028 Ga0070717_10000021 Ga0070717_1000002159 131
75 3300006844 Ga0075428_100355419 Ga0075428_1003554191 131
76 3300006847 Ga0075431_100042772 Ga0075431_1000427724 131
77 3300006852 Ga0075433_10223844 Ga0075433_102238443 131
78 3300006871 Ga0075434_100197407 Ga0075434_1001974073 131
79 3300006931 Ga0097620_100124575 Ga0097620_1001245752 131
80 3300006931 Ga0097620_101795873 Ga0097620_1017958731 131
81 3300009094 Ga0111539_10561539 Ga0111539_105615393 131
82 3300009147 Ga0114129_10123519 Ga0114129_101235193 131
83 3300014969 Ga0157376_10142734 Ga0157376_101427343 131
84 3300025912 Ga0207707_10155304 Ga0207707_101553042 131
85 3300025915 Ga0207693_10376334 Ga0207693_103763342 131
86 3300025917 Ga0207660_10199029 Ga0207660_101990292 131
87 3300025921 Ga0207652_10161846 Ga0207652_101618463 131
88 3300025944 Ga0207661_10832287 Ga0207661_108322872 131
89 3300026035 Ga0207703_10085287 Ga0207703_100852871 131
90 3300026116 Ga0207674_11253843 Ga0207674_112538432 131
91 3300026116 Ga0207674_11811691 Ga0207674_118116911 131
92 3300031251 Ga0265327_10001140 Ga0265327_1000114021 131
93 3300035085 Ga0373929_0086170 Ga0373929_0086170_205_615 131
94 3300037068 Ga0373925_0180018 Ga0373925_0180018_844_1245 131
95 3300041463 Ga0451804_1160486 Ga0451804_1160486_122_544 131
96 3300044684 Ga0466966_0116471 Ga0466966_0116471_716_1195 131
97 3300045051 Ga0451576_2489798 Ga0451576_2489798_37_435 131
98 3300046472 Ga0495580_0670756 Ga0495580_0670756_98_499 131
99 3300046522 Ga0495643_0000003 Ga0495643_0000003_69609_70007 131
100 3300046663 Ga0495635_0166255 Ga0495635_0166255_154_561 131
101 3300046810 Ga0495660_0311275 Ga0495660_0311275_194_604 131
102 3300048907 Ga0496104_0663824 Ga0496104_0663824_390_845 131
103 3300048916 Ga0496113_0246647 Ga0496113_0246647_696_1151 131
104 3300048927 Ga0496124_0280176 Ga0496124_0280176_254_706 131
105 3300049570 Ga0501033_0272053 Ga0501033_0272053_420_887 131
106 3300049576 Ga0501040_0902980 Ga0501040_0902980_110_520 131
107 3300049579 Ga0501043_0312642 Ga0501043_0312642_630_1097 131
108 3300049588 Ga0501072_0427810 Ga0501072_0427810_373_783 131
109 3300049590 Ga0501074_1294474 Ga0501074_1294474_24_491 131
110 3300050507 nmdc:mga05p37_321327_c1 nmdc:mga05p37_321327_c1_626_1033 131
111 3300050512 nmdc:mga0n895_167478_c1 nmdc:mga0n895_167478_c1_842_1249 131
112 3300050513 nmdc:mga0rr50_511103_c1 nmdc:mga0rr50_511103_c1_46_441 131
113 3300050514 nmdc:mga08x19_345479_c1 nmdc:mga08x19_345479_c1_633_1028 131
114 3300050515 nmdc:mga0a205_283224_c1 nmdc:mga0a205_283224_c1_301_708 131
115 3300005467 Ga0070706_100170883 Ga0070706_1001708832 132
116 3300005468 Ga0070707_100004939 Ga0070707_1000049395 132
117 3300005518 Ga0070699_100110444 Ga0070699_1001104442 132
118 3300005536 Ga0070697_101136337 Ga0070697_1011363371 132
119 3300005937 Ga0081455_10459538 Ga0081455_104595381 132
120 3300025910 Ga0207684_10169384 Ga0207684_101693842 132
121 3300025922 Ga0207646_10002998 Ga0207646_1000299817 132
122 2162886012 MBSR1b_contig_1253721 MBSR1b_0832.00003860 133
123 3300006852 Ga0075433_10237854 Ga0075433_102378542 133
124 3300006871 Ga0075434_100087993 Ga0075434_1000879933 133
125 3300035088 Ga0373940_0195330 Ga0373940_0195330_10_411 133
126 3300035121 Ga0373960_0065452 Ga0373960_0065452_28_429 133
127 3300035691 Ga0373931_0224773 Ga0373931_0224773_567_968 133
128 3300048915 Ga0496112_0297232 Ga0496112_0297232_271_672 133
129 3300050512 nmdc:mga0n895_199225_c1 nmdc:mga0n895_199225_c1_529_930 133
130 3300050515 nmdc:mga0a205_1123926_c1 nmdc:mga0a205_1123926_c1_43_444 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19571

ACT_8

ACT domain pair

1

129

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8771 3 67
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8206 3 67
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.816 2 133
5fii-assembly2.cif.gz_D structure of a human aspartate kinase, chorismate mutase and tyra domain. 0.8033 1 71
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.7777 2 133
ID Description Score Start End Superfamily
af_K7KPI3_232_352_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8826 3 50 3.30.70.260
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8798 2 47 3.40.50.2000
af_P27249_815_877_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8744 3 53 3.30.70.260
af_I1MCA5_224_286_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8731 4 50 3.30.460.10
af_O81900_105_207_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8704 2 49 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A0A8DTV5-F1-model_v4 deleted 0.9908 1 132
AF-A0A7W0LZT9-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9868 1 131
AF-D0RK84-F1-model_v4 deleted 0.9847 2 126
AF-A0A7K1Y816-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9835 1 130
AF-A0A7C3FYQ9-F1-model_v4 Amino acid-binding ACT domain-containing protein 0.9806 1 127

Feature Viewer

pLDDT pTM Quality
94.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map