F145122

General Info

Members Datasets Scaffolds Average Seq Length
130 102 260 151

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_101167455|Ga0075431_1011674552
Length 169
Sequence MNISECTILLAEDDPDAVFLLRRALQKADVKNPIEVARDGQEAIDYLSNQGAYADRERYRLPALMLLDLKMPRKSGFEVLEWLRQQPGLKRLIVVVLTSSNQVADINRAYDLGSNSYLVKPADFDALINMGRDIGQYWLALNERPELQNNSASALLSAQHSACVSEVSS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
102 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0.77
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 32.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_101167455 3300006847 Bacteria 733
2 JGI25406J46586_10109401 3300003203 Bacteria 819
3 Ga0058861_11865312 3300004800 Bacteria 772
4 Ga0070658_10019391 3300005327 Bacteria 5447
5 Ga0070676_10006534 3300005328 Bacteria 6230
6 Ga0070683_100089061 3300005329 Bacteria 2896
7 Ga0070683_100089227 3300005329 Bacteria 2893
8 Ga0070671_101164705 3300005355 Unclassified 678
9 Ga0070688_100945941 3300005365 Unclassified 682
10 Ga0070667_100267134 3300005367 Bacteria 1533
11 Ga0070709_10757574 3300005434 Unclassified 759
12 Ga0070714_100039135 3300005435 Unclassified 3990
13 Ga0070713_100046909 3300005436 Bacteria 3548
14 Ga0070713_100090890 3300005436 Bacteria 2625
15 Ga0070710_10864087 3300005437 Unclassified 650
16 Ga0070705_100209196 3300005440 Unclassified 1343
17 Ga0070694_100075889 3300005444 Bacteria 2326
18 Ga0070678_100869506 3300005456 Bacteria 822
19 Ga0068867_100550918 3300005459 Unclassified 999
20 Ga0070698_100125366 3300005471 Bacteria 2525
21 Ga0070684_100010923 3300005535 Bacteria 7216
22 Ga0068857_101214482 3300005577 Unclassified 730
23 Ga0068856_100746077 3300005614 Bacteria 999
24 Ga0070702_100252739 3300005615 Bacteria 1196
25 Ga0068863_100343968 3300005841 Unclassified 1451
26 Ga0068863_100972257 3300005841 Unclassified 851
27 Ga0068863_101625381 3300005841 Unclassified 655
28 Ga0081539_10011197 3300005985 Bacteria 7141
29 Ga0070716_100634473 3300006173 Bacteria 808
30 Ga0068871_100171914 3300006358 Bacteria 1858
31 Ga0068871_100194437 3300006358 Bacteria 1749
32 Ga0075431_100118856 3300006847 Bacteria 2727
33 Ga0075433_10205537 3300006852 Unclassified 1751
34 Ga0075433_11577385 3300006852 Unclassified 566
35 Ga0075434_100003215 3300006871 Bacteria 14570
36 Ga0075434_100072989 3300006871 Bacteria 3424
37 Ga0068865_101172988 3300006881 Unclassified 679
38 Ga0075435_101410679 3300007076 Bacteria 610
39 Ga0105240_10031924 3300009093 Bacteria 6823
40 Ga0105241_11302546 3300009174 Unclassified 692
41 Ga0105242_10879059 3300009176 Unclassified 894
42 Ga0105238_11143641 3300009551 Bacteria 802
43 Ga0157369_10059648 3300013105 Bacteria 4114
44 Ga0157369_10249982 3300013105 Bacteria 1851
45 Ga0157369_10395850 3300013105 Unclassified 1433
46 Ga0157374_10542606 3300013296 Bacteria 1170
47 Ga0157372_10000478 3300013307 Bacteria 44164
48 Ga0157372_10004893 3300013307 Bacteria 14240
49 Ga0157375_10120271 3300013308 Bacteria 2735
50 Ga0163163_10074433 3300014325 Bacteria 3388
51 Ga0163163_11147434 3300014325 Bacteria 840
52 Ga0157379_10057582 3300014968 Bacteria 3473
53 Ga0213874_10224034 3300021377 Unclassified 684
54 Ga0213876_10046805 3300021384 Bacteria 2287
55 Ga0207692_10261883 3300025898 Unclassified 1040
56 Ga0207645_10043299 3300025907 Bacteria 2881
57 Ga0207705_10518232 3300025909 Bacteria 926
58 Ga0207694_10768266 3300025924 Bacteria 814
59 Ga0207661_10006420 3300025944 Bacteria 8316
60 Ga0207708_10694630 3300026075 Unclassified 869
61 Ga0207641_10381191 3300026088 Unclassified 1350
62 Ga0207641_10948143 3300026088 Unclassified 856
63 Ga0207648_10244989 3300026089 Bacteria 1597
64 Ga0207674_10438269 3300026116 Bacteria 1263
65 Ga0307413_10024622 3300031824 Bacteria 3285
66 Ga0307410_10217649 3300031852 Bacteria 1467
67 Ga0307410_10235792 3300031852 Bacteria 1415
68 Ga0307406_10487381 3300031901 Bacteria 997
69 Ga0307416_100929001 3300032002 Bacteria 971
70 Ga0307414_10766000 3300032004 Bacteria 878
71 Ga0307411_10296723 3300032005 Bacteria 1294
72 Ga0307415_100074342 3300032126 Bacteria 2402
73 Ga0373953_0177602 3300035117 Unclassified 918
74 Ga0373954_0285772 3300035118 Unclassified 813
75 Ga0373943_0344625 3300035170 Unclassified 853
76 Ga0373955_0010475 3300035172 Bacteria 4382
77 Ga0373935_0058480 3300035692 Bacteria 2463
78 Ga0373933_0095323 3300035724 Bacteria 1841
79 Ga0373937_0035351 3300036401 Bacteria 4548
80 Ga0373937_0626796 3300036401 Unclassified 1020
81 Ga0373925_0410575 3300037068 Unclassified 1105
82 Ga0436364_0031126 3300037853 Bacteria 1312
83 Ga0436365_1771390 3300039437 Bacteria 2297
84 Ga0436360_0475175 3300039438 Unclassified 1167
85 Ga0436363_0364115 3300039450 Bacteria 4432
86 Ga0451577_0383363 3300042876 Bacteria 1276
87 Ga0466972_0005252 3300044658 Bacteria 6483
88 Ga0466966_0164540 3300044684 Unclassified 1350
89 Ga0466961_0747329 3300044693 Unclassified 585
90 Ga0466963_0021466 3300044694 Bacteria 4074
91 Ga0466963_0136888 3300044694 Unclassified 1695
92 Ga0466963_0314441 3300044694 Bacteria 1102
93 Ga0466963_1077598 3300044694 Unclassified 565
94 Ga0466964_0274415 3300044706 Unclassified 840
95 Ga0453684_0005414 3300044712 Bacteria 25289
96 Ga0453684_1082676 3300044712 Unclassified 848
97 Ga0466968_0196005 3300044735 Bacteria 944
98 Ga0466960_0390627 3300044901 Bacteria 800
99 Ga0466959_0035008 3300045049 Bacteria 3714
100 Ga0466959_0054889 3300045049 Bacteria 2910
101 Ga0451576_0055288 3300045051 Bacteria 4153
102 Ga0451576_0092146 3300045051 Unclassified 3152
103 Ga0451576_1069435 3300045051 Bacteria 845
104 Ga0466967_0008042 3300045976 Bacteria 7686
105 Ga0466967_0016271 3300045976 Bacteria 5859
106 Ga0495628_0064328 3300046516 Bacteria 2872
107 Ga0495630_0021538 3300046517 Bacteria 4760
108 Ga0495634_0249853 3300046642 Bacteria 1085
109 Ga0495635_0548063 3300046663 Unclassified 758
110 Ga0495657_0024166 3300046675 Bacteria 4332
111 Ga0495657_0274359 3300046675 Bacteria 1010
112 Ga0495623_0350547 3300046679 Unclassified 804
113 Ga0495647_0469774 3300046681 Unclassified 584
114 Ga0495669_0032731 3300046684 Bacteria 2286
115 Ga0495613_0566234 3300046689 Unclassified 759
116 Ga0495604_0806265 3300047317 Unclassified 591
117 Ga0495602_1110955 3300048088 Unclassified 518
118 Ga0501083_0054219 3300049744 Bacteria 2691
119 nmdc:mga05p37_14397_c1 3300050507 Bacteria 9496
120 nmdc:mga06r32_1023567_c1 3300050510 Bacteria 778
121 nmdc:mga06r32_512287_c1 3300050510 Bacteria 1176
122 nmdc:mga08y16_356832_c1 3300050511 Bacteria 1501
123 nmdc:mga0n895_12033_c1 3300050512 Bacteria 7745
124 nmdc:mga0n895_2747_c1 3300050512 Bacteria 13891
125 nmdc:mga0n895_70979_c1 3300050512 Bacteria 3452
126 nmdc:mga0rr50_424156_c1 3300050513 Bacteria 1125
127 nmdc:mga0a205_1219863_c1 3300050515 Unclassified 600
128 nmdc:mga0a205_49084_c1 3300050515 Bacteria 4073
129 2886629947 2886627955 Bacteria 7618130
130 2913914601 2913912277 Bacteria 9037797
131 Ga0075431_101167455
132 JGI25406J46586_10109401
133 Ga0058861_11865312
134 Ga0070658_10019391
135 Ga0070676_10006534
136 Ga0070683_100089061
137 Ga0070683_100089227
138 Ga0070671_101164705
139 Ga0070688_100945941
140 Ga0070667_100267134
141 Ga0070709_10757574
142 Ga0070714_100039135
143 Ga0070713_100046909
144 Ga0070713_100090890
145 Ga0070710_10864087
146 Ga0070705_100209196
147 Ga0070694_100075889
148 Ga0070678_100869506
149 Ga0068867_100550918
150 Ga0070698_100125366
151 Ga0070684_100010923
152 Ga0068857_101214482
153 Ga0068856_100746077
154 Ga0070702_100252739
155 Ga0068863_100343968
156 Ga0068863_100972257
157 Ga0068863_101625381
158 Ga0081539_10011197
159 Ga0070716_100634473
160 Ga0068871_100171914
161 Ga0068871_100194437
162 Ga0075431_100118856
163 Ga0075433_10205537
164 Ga0075433_11577385
165 Ga0075434_100003215
166 Ga0075434_100072989
167 Ga0068865_101172988
168 Ga0075435_101410679
169 Ga0105240_10031924
170 Ga0105241_11302546
171 Ga0105242_10879059
172 Ga0105238_11143641
173 Ga0157369_10059648
174 Ga0157369_10249982
175 Ga0157369_10395850
176 Ga0157374_10542606
177 Ga0157372_10000478
178 Ga0157372_10004893
179 Ga0157375_10120271
180 Ga0163163_10074433
181 Ga0163163_11147434
182 Ga0157379_10057582
183 Ga0213874_10224034
184 Ga0213876_10046805
185 Ga0207692_10261883
186 Ga0207645_10043299
187 Ga0207705_10518232
188 Ga0207694_10768266
189 Ga0207661_10006420
190 Ga0207708_10694630
191 Ga0207641_10381191
192 Ga0207641_10948143
193 Ga0207648_10244989
194 Ga0207674_10438269
195 Ga0307413_10024622
196 Ga0307410_10217649
197 Ga0307410_10235792
198 Ga0307406_10487381
199 Ga0307416_100929001
200 Ga0307414_10766000
201 Ga0307411_10296723
202 Ga0307415_100074342
203 Ga0373953_0177602
204 Ga0373954_0285772
205 Ga0373943_0344625
206 Ga0373955_0010475
207 Ga0373935_0058480
208 Ga0373933_0095323
209 Ga0373937_0035351
210 Ga0373937_0626796
211 Ga0373925_0410575
212 Ga0436364_0031126
213 Ga0436365_1771390
214 Ga0436360_0475175
215 Ga0436363_0364115
216 Ga0451577_0383363
217 Ga0466972_0005252
218 Ga0466966_0164540
219 Ga0466961_0747329
220 Ga0466963_0021466
221 Ga0466963_0136888
222 Ga0466963_0314441
223 Ga0466963_1077598
224 Ga0466964_0274415
225 Ga0453684_0005414
226 Ga0453684_1082676
227 Ga0466968_0196005
228 Ga0466960_0390627
229 Ga0466959_0035008
230 Ga0466959_0054889
231 Ga0451576_0055288
232 Ga0451576_0092146
233 Ga0451576_1069435
234 Ga0466967_0008042
235 Ga0466967_0016271
236 Ga0495628_0064328
237 Ga0495630_0021538
238 Ga0495634_0249853
239 Ga0495635_0548063
240 Ga0495657_0024166
241 Ga0495657_0274359
242 Ga0495623_0350547
243 Ga0495647_0469774
244 Ga0495669_0032731
245 Ga0495613_0566234
246 Ga0495604_0806265
247 Ga0495602_1110955
248 Ga0501083_0054219
249 nmdc:mga05p37_14397_c1
250 nmdc:mga06r32_1023567_c1
251 nmdc:mga06r32_512287_c1
252 nmdc:mga08y16_356832_c1
253 nmdc:mga0n895_12033_c1
254 nmdc:mga0n895_2747_c1
255 nmdc:mga0n895_70979_c1
256 nmdc:mga0rr50_424156_c1
257 nmdc:mga0a205_1219863_c1
258 nmdc:mga0a205_49084_c1
259 2886629947
260 2913914601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

132

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k66-assembly1.cif.gz_B crystal structure of the cyanobacterial phytochrome response regulator, rcpb 0.9568 4 145
4zyl-assembly1.cif.gz_A crystal structure of response regulator rpa3017 in red light signaling of r. palustris 0.9444 5 145
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.9443 5 145
6xvu-assembly2.cif.gz_C bacteriophytochrome response regulator from deinococcus radiodurans 0.9332 5 145
1k66-assembly1.cif.gz_B crystal structure of the cyanobacterial phytochrome response regulator, rcpb 0.9314 4 145
ID Description Score Start End Superfamily
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9568 4 145 3.40.50.2300
4zylA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9443 5 145 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9416 5 145 3.40.50.2300
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9314 4 145 3.40.50.2300
4zylA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9255 5 145 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A661T4U5-F1-model_v4 Response regulator 0.9941 3 145 GO:0000160
AF-A0A290Q4B6-F1-model_v4 Two-component system response regulator 0.9927 4 145 GO:0000160
AF-O28799-F1-model_v4 Response regulator 0.9906 5 145 GO:0000160
AF-A0A1E7JBB2-F1-model_v4 Response regulatory domain-containing protein 0.9892 3 145 GO:0000160
AF-A0A2V5W9Y8-F1-model_v4 Two-component system response regulator 0.9888 5 145 GO:0000160

Map