F145054

General Info

Members Datasets Scaffolds Average Seq Length
130 102 130 246

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10031453|Ga0075366_100314532
Length 267
Sequence MALGSGIEWTESTWNPVTGCNKLSPGCKHCYAERMAERLQAMGQPNYRNGFKLTLQPQMLKLPLHWKKPQTIFVNSMSDLFHKDVPLTYIQSVFSVMRAAHWHRFQVLTKRADRLAELSPSIEWPENVWMGVSVENDKYVDRIDDLRVAGACVKFLSLEPLLGPLPKLNLRGIDWAIVGGESGPRARPMDPAWVIDIRDQCHRAGVAFFFKQWGGKNKKKTGRILEGRTWDEMPTTPSTGAVVRARPGRAQVRLRQMSSPARRMRHG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
79 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
98 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
99 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 0
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10126207 3300003316 Bacteria 1640
2 Ga0070690_100053466 3300005330 Unclassified 2583
3 Ga0070682_100135095 3300005337 Bacteria 1674
4 Ga0070674_100124251 3300005356 Bacteria 1914
5 Ga0070667_100029571 3300005367 Unclassified 4567
6 Ga0070709_10146723 3300005434 Bacteria 1626
7 Ga0070706_100003393 3300005467 Bacteria 15707
8 Ga0070707_100441229 3300005468 Unclassified 1262
9 Ga0070698_100005561 3300005471 Bacteria 13777
10 Ga0070698_100078437 3300005471 Bacteria 3301
11 Ga0070699_100008601 3300005518 Bacteria 8845
12 Ga0070665_100020565 3300005548 Bacteria 6632
13 Ga0070665_100405160 3300005548 Bacteria 1372
14 Ga0068855_100000020 3300005563 Bacteria 205600
15 Ga0068852_100358834 3300005616 Bacteria 1425
16 Ga0068864_100074069 3300005618 Unclassified 2970
17 Ga0068866_10082445 3300005718 Unclassified 1730
18 Ga0068863_100038738 3300005841 Bacteria 4535
19 Ga0068863_100073401 3300005841 Unclassified 3237
20 Ga0068863_100317364 3300005841 Unclassified 1513
21 Ga0068858_100072725 3300005842 Unclassified 3190
22 Ga0068858_100897772 3300005842 Bacteria 866
23 Ga0068860_100005273 3300005843 Bacteria 13120
24 Ga0068860_100024205 3300005843 Bacteria 5871
25 Ga0068860_100204355 3300005843 Bacteria 1915
26 Ga0070717_10005720 3300006028 Bacteria 9093
27 Ga0075366_10011640 3300006195 Bacteria 4971
28 Ga0075366_10031453 3300006195 Bacteria 3123
29 Ga0097621_100032692 3300006237 Unclassified 4137
30 Ga0068871_100010475 3300006358 Bacteria 6768
31 Ga0075428_100000218 3300006844 Bacteria 55439
32 Ga0075431_100163610 3300006847 Bacteria 2287
33 Ga0075434_100224489 3300006871 Bacteria 1898
34 Ga0075436_100003566 3300006914 Bacteria 10667
35 Ga0075435_100305557 3300007076 Bacteria 1361
36 Ga0099794_10087037 3300007265 Bacteria 1547
37 Ga0111539_10002320 3300009094 Bacteria 25331
38 Ga0114129_10576706 3300009147 Unclassified 1460
39 Ga0157374_10061044 3300013296 Unclassified 3529
40 Ga0157378_10040490 3300013297 Unclassified 4132
41 Ga0163162_10018127 3300013306 Bacteria 6893
42 Ga0157375_10014197 3300013308 Bacteria 7101
43 Ga0163163_10013509 3300014325 Bacteria 7482
44 Ga0157379_10025273 3300014968 Bacteria 5275
45 Ga0157376_10043002 3300014969 Unclassified 3706
46 Ga0207642_10063975 3300025899 Unclassified 1723
47 Ga0207684_10014108 3300025910 Bacteria 6901
48 Ga0207646_10127787 3300025922 Unclassified 2286
49 Ga0207669_10099851 3300025937 Bacteria 1915
50 Ga0207711_10010085 3300025941 Bacteria 7854
51 Ga0207667_10000258 3300025949 Bacteria 74576
52 Ga0207667_10448688 3300025949 Unclassified 1311
53 Ga0207703_10238372 3300026035 Bacteria 1634
54 Ga0207703_10837260 3300026035 Bacteria 879
55 Ga0207641_10420822 3300026088 Bacteria 1286
56 Ga0207641_10880876 3300026088 Unclassified 888
57 Ga0207676_10034037 3300026095 Unclassified 3854
58 Ga0207674_10649006 3300026116 Bacteria 1019
59 Ga0207428_10004640 3300027907 Bacteria 13020
60 Ga0268266_10020461 3300028379 Bacteria 5640
61 Ga0268266_10359414 3300028379 Bacteria 1370
62 Ga0268264_10000012 3300028381 Bacteria 521740
63 Ga0268264_10005756 3300028381 Bacteria 10510
64 Ga0265337_1047961 3300028556 Unclassified 1210
65 Ga0265319_1000003 3300028563 Bacteria 340561
66 Ga0265323_10003005 3300028653 Bacteria 7532
67 Ga0307515_10137722 3300028794 Bacteria 2640
68 Ga0265338_10010153 3300028800 Bacteria 11103
69 Ga0265338_10046457 3300028800 Bacteria 3979
70 Ga0265338_10054475 3300028800 Bacteria 3566
71 Ga0265330_10000005 3300031235 Bacteria 246580
72 Ga0265332_10000061 3300031238 Bacteria 95647
73 Ga0265328_10015834 3300031239 Bacteria 2948
74 Ga0265320_10015990 3300031240 Bacteria 4220
75 Ga0265320_10028930 3300031240 Bacteria 2873
76 Ga0265325_10037399 3300031241 Bacteria 2566
77 Ga0265329_10001414 3300031242 Bacteria 11615
78 Ga0265339_10022600 3300031249 Bacteria 3643
79 Ga0265331_10044282 3300031250 Unclassified 2153
80 Ga0265316_10000015 3300031344 Bacteria 199947
81 Ga0307513_10005697 3300031456 Bacteria 16390
82 Ga0265313_10154392 3300031595 Unclassified 978
83 Ga0307508_10034189 3300031616 Bacteria 4584
84 Ga0265314_10000005 3300031711 Bacteria 668532
85 Ga0265314_10000985 3300031711 Bacteria 33545
86 Ga0265342_10000646 3300031712 Bacteria 36574
87 Ga0265342_10002936 3300031712 Bacteria 14334
88 Ga0265342_10026001 3300031712 Bacteria 3672
89 Ga0307413_10474127 3300031824 Bacteria 999
90 Ga0307410_10103741 3300031852 Bacteria 2043
91 Ga0307406_10007229 3300031901 Bacteria 6152
92 Ga0307411_10531877 3300032005 Bacteria 1000
93 Ga0307415_100073544 3300032126 Bacteria 2412
94 Ga0316584_0289933 3300036712 Unclassified 1187
95 Ga0400490_49057 3300038726 Bacteria 8594
96 Ga0439462_0008214 3300042015 Bacteria 2627
97 Ga0439435_0031151 3300042436 Bacteria 1449
98 Ga0439460_0086677 3300042461 Bacteria 990
99 Ga0451577_0177576 3300042876 Bacteria 1920
100 Ga0466969_0019056 3300044656 Bacteria 3570
101 Ga0466966_0000018 3300044684 Bacteria 122605
102 Ga0453684_0000074 3300044712 Bacteria 438364
103 Ga0453684_0022812 3300044712 Bacteria 9269
104 Ga0453684_0083559 3300044712 Bacteria 3974
105 Ga0453684_0116612 3300044712 Bacteria 3233
106 Ga0453684_0146867 3300044712 Archaea 2807
107 Ga0453684_0202531 3300044712 Bacteria 2313
108 Ga0453684_0353896 3300044712 Bacteria 1655
109 Ga0453684_0455264 3300044712 Unclassified 1424
110 Ga0466959_0000002 3300045049 Bacteria 362671
111 Ga0495592_0096557 3300046454 Bacteria 2112
112 Ga0495628_0018257 3300046516 Bacteria 5815
113 Ga0495672_0019322 3300047320 Bacteria 4497
114 Ga0495675_0138606 3300047444 Bacteria 1509
115 Ga0495686_0016050 3300047472 Bacteria 5090
116 Ga0495686_0022531 3300047472 Bacteria 4168
117 Ga0495682_0068903 3300049460 Bacteria 1274
118 Ga0501047_0335098 3300049581 Bacteria 1351
119 Ga0501070_0306085 3300049586 Bacteria 1294
120 Ga0501044_0118913 3300049823 Bacteria 2645
121 nmdc:mga0k408_10593_c1 3300050493 Bacteria 4990
122 nmdc:mga0k408_82020_c1 3300050493 Bacteria 1889
123 nmdc:mga08y16_12965_c1 3300050511 Bacteria 8771
124 nmdc:mga0n895_523913_c1 3300050512 Bacteria 1193
125 nmdc:mga08x19_1568_c1 3300050514 Bacteria 14182
126 nmdc:mga0a205_54574_c1 3300050515 Bacteria 3859
127 Ga0500646_0002022 3300053090 Bacteria 5294
128 Ga0500616_0014916 3300053153 Bacteria 4453
129 Ga0501082_0000163 3300060353 Bacteria 56753
130 Ga0530510_0318363 3300061734 Bacteria 1166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_523913_c1 nmdc:mga0n895_523913_c1_204_866 205
2 3300061734 Ga0530510_0318363 Ga0530510_0318363_23_721 217
3 3300036712 Ga0316584_0289933 Ga0316584_0289933_81_752 223
4 3300053090 Ga0500646_0002022 Ga0500646_0002022_3927_4682 226
5 3300028794 Ga0307515_10137722 Ga0307515_101377222 227
6 3300005330 Ga0070690_100053466 Ga0070690_1000534664 228
7 3300005842 Ga0068858_100072725 Ga0068858_1000727252 228
8 3300013306 Ga0163162_10018127 Ga0163162_100181275 228
9 3300013308 Ga0157375_10014197 Ga0157375_100141974 228
10 3300014325 Ga0163163_10013509 Ga0163163_100135095 228
11 3300026035 Ga0207703_10238372 Ga0207703_102383722 228
12 3300028381 Ga0268264_10000012 Ga0268264_10000012354 228
13 3300005337 Ga0070682_100135095 Ga0070682_1001350951 234
14 3300005471 Ga0070698_100078437 Ga0070698_1000784373 236
15 3300005616 Ga0068852_100358834 Ga0068852_1003588342 236
16 3300006844 Ga0075428_100000218 Ga0075428_1000002186 236
17 3300005468 Ga0070707_100441229 Ga0070707_1004412291 237
18 3300031852 Ga0307410_10103741 Ga0307410_101037412 237
19 3300042876 Ga0451577_0177576 Ga0451577_0177576_1113_1826 237
20 3300060353 Ga0501082_0000163 Ga0501082_0000163_28638_29351 237
21 3300005367 Ga0070667_100029571 Ga0070667_1000295711 238
22 3300005618 Ga0068864_100074069 Ga0068864_1000740692 238
23 3300005841 Ga0068863_100073401 Ga0068863_1000734014 238
24 3300005843 Ga0068860_100005273 Ga0068860_1000052733 238
25 3300006028 Ga0070717_10005720 Ga0070717_100057206 238
26 3300006237 Ga0097621_100032692 Ga0097621_1000326924 238
27 3300006358 Ga0068871_100010475 Ga0068871_1000104755 238
28 3300009094 Ga0111539_10002320 Ga0111539_100023206 238
29 3300013296 Ga0157374_10061044 Ga0157374_100610441 238
30 3300013297 Ga0157378_10040490 Ga0157378_100404905 238
31 3300014968 Ga0157379_10025273 Ga0157379_100252734 238
32 3300014969 Ga0157376_10043002 Ga0157376_100430022 238
33 3300025941 Ga0207711_10010085 Ga0207711_100100855 238
34 3300026095 Ga0207676_10034037 Ga0207676_100340371 238
35 3300027907 Ga0207428_10004640 Ga0207428_1000464010 238
36 3300028800 Ga0265338_10054475 Ga0265338_100544752 238
37 3300044656 Ga0466969_0019056 Ga0466969_0019056_1705_2427 238
38 3300044684 Ga0466966_0000018 Ga0466966_0000018_44689_45411 238
39 3300044712 Ga0453684_0083559 Ga0453684_0083559_2832_3581 238
40 3300045049 Ga0466959_0000002 Ga0466959_0000002_105203_105925 238
41 3300050511 nmdc:mga08y16_12965_c1 nmdc:mga08y16_12965_c1_3467_4183 238
42 3300053153 Ga0500616_0014916 Ga0500616_0014916_3249_3983 238
43 3300003316 rootH1_10126207 rootH1_101262072 239
44 3300005356 Ga0070674_100124251 Ga0070674_1001242512 239
45 3300005434 Ga0070709_10146723 Ga0070709_101467232 239
46 3300005467 Ga0070706_100003393 Ga0070706_1000033939 239
47 3300005471 Ga0070698_100005561 Ga0070698_1000055612 239
48 3300005518 Ga0070699_100008601 Ga0070699_1000086011 239
49 3300005548 Ga0070665_100020565 Ga0070665_1000205654 239
50 3300005548 Ga0070665_100405160 Ga0070665_1004051602 239
51 3300005563 Ga0068855_100000020 Ga0068855_100000020133 239
52 3300005718 Ga0068866_10082445 Ga0068866_100824452 239
53 3300005841 Ga0068863_100038738 Ga0068863_1000387382 239
54 3300005841 Ga0068863_100317364 Ga0068863_1003173643 239
55 3300005842 Ga0068858_100897772 Ga0068858_1008977721 239
56 3300005843 Ga0068860_100024205 Ga0068860_1000242052 239
57 3300005843 Ga0068860_100204355 Ga0068860_1002043552 239
58 3300006195 Ga0075366_10011640 Ga0075366_100116403 239
59 3300006195 Ga0075366_10031453 Ga0075366_100314532 239
60 3300006847 Ga0075431_100163610 Ga0075431_1001636102 239
61 3300006871 Ga0075434_100224489 Ga0075434_1002244892 239
62 3300006914 Ga0075436_100003566 Ga0075436_1000035661 239
63 3300007076 Ga0075435_100305557 Ga0075435_1003055572 239
64 3300007265 Ga0099794_10087037 Ga0099794_100870372 239
65 3300009147 Ga0114129_10576706 Ga0114129_105767062 239
66 3300025899 Ga0207642_10063975 Ga0207642_100639752 239
67 3300025910 Ga0207684_10014108 Ga0207684_100141084 239
68 3300025922 Ga0207646_10127787 Ga0207646_101277872 239
69 3300025937 Ga0207669_10099851 Ga0207669_100998512 239
70 3300025949 Ga0207667_10000258 Ga0207667_1000025862 239
71 3300025949 Ga0207667_10448688 Ga0207667_104486882 239
72 3300026035 Ga0207703_10837260 Ga0207703_108372601 239
73 3300026088 Ga0207641_10420822 Ga0207641_104208221 239
74 3300026088 Ga0207641_10880876 Ga0207641_108808761 239
75 3300026116 Ga0207674_10649006 Ga0207674_106490061 239
76 3300028379 Ga0268266_10020461 Ga0268266_100204614 239
77 3300028379 Ga0268266_10359414 Ga0268266_103594141 239
78 3300028381 Ga0268264_10005756 Ga0268264_100057563 239
79 3300028556 Ga0265337_1047961 Ga0265337_10479611 239
80 3300028563 Ga0265319_1000003 Ga0265319_1000003233 239
81 3300028653 Ga0265323_10003005 Ga0265323_100030053 239
82 3300028800 Ga0265338_10010153 Ga0265338_1001015310 239
83 3300028800 Ga0265338_10046457 Ga0265338_100464575 239
84 3300031235 Ga0265330_10000005 Ga0265330_10000005159 239
85 3300031238 Ga0265332_10000061 Ga0265332_1000006133 239
86 3300031239 Ga0265328_10015834 Ga0265328_100158342 239
87 3300031240 Ga0265320_10015990 Ga0265320_100159902 239
88 3300031240 Ga0265320_10028930 Ga0265320_100289303 239
89 3300031241 Ga0265325_10037399 Ga0265325_100373993 239
90 3300031242 Ga0265329_10001414 Ga0265329_100014145 239
91 3300031249 Ga0265339_10022600 Ga0265339_100226005 239
92 3300031250 Ga0265331_10044282 Ga0265331_100442822 239
93 3300031344 Ga0265316_10000015 Ga0265316_1000001551 239
94 3300031456 Ga0307513_10005697 Ga0307513_100056973 239
95 3300031595 Ga0265313_10154392 Ga0265313_101543921 239
96 3300031616 Ga0307508_10034189 Ga0307508_100341895 239
97 3300031711 Ga0265314_10000005 Ga0265314_10000005130 239
98 3300031711 Ga0265314_10000985 Ga0265314_1000098526 239
99 3300031712 Ga0265342_10000646 Ga0265342_1000064623 239
100 3300031712 Ga0265342_10002936 Ga0265342_100029363 239
101 3300031712 Ga0265342_10026001 Ga0265342_100260011 239
102 3300031824 Ga0307413_10474127 Ga0307413_104741271 239
103 3300031901 Ga0307406_10007229 Ga0307406_100072294 239
104 3300032005 Ga0307411_10531877 Ga0307411_105318772 239
105 3300032126 Ga0307415_100073544 Ga0307415_1000735442 239
106 3300038726 Ga0400490_49057 Ga0400490_49057_3518_4252 239
107 3300042015 Ga0439462_0008214 Ga0439462_0008214_578_1345 239
108 3300042436 Ga0439435_0031151 Ga0439435_0031151_582_1349 239
109 3300042461 Ga0439460_0086677 Ga0439460_0086677_134_898 239
110 3300044712 Ga0453684_0000074 Ga0453684_0000074_288273_289001 239
111 3300044712 Ga0453684_0022812 Ga0453684_0022812_1584_2309 239
112 3300044712 Ga0453684_0116612 Ga0453684_0116612_62_790 239
113 3300044712 Ga0453684_0146867 Ga0453684_0146867_802_1524 239
114 3300044712 Ga0453684_0202531 Ga0453684_0202531_1128_1877 239
115 3300044712 Ga0453684_0353896 Ga0453684_0353896_315_1097 239
116 3300044712 Ga0453684_0455264 Ga0453684_0455264_684_1412 239
117 3300046454 Ga0495592_0096557 Ga0495592_0096557_519_1280 239
118 3300046516 Ga0495628_0018257 Ga0495628_0018257_4134_4895 239
119 3300047320 Ga0495672_0019322 Ga0495672_0019322_262_1056 239
120 3300047444 Ga0495675_0138606 Ga0495675_0138606_78_839 239
121 3300047472 Ga0495686_0016050 Ga0495686_0016050_573_1325 239
122 3300047472 Ga0495686_0022531 Ga0495686_0022531_2958_3725 239
123 3300049460 Ga0495682_0068903 Ga0495682_0068903_92_859 239
124 3300049581 Ga0501047_0335098 Ga0501047_0335098_287_1018 239
125 3300049586 Ga0501070_0306085 Ga0501070_0306085_440_1213 239
126 3300049823 Ga0501044_0118913 Ga0501044_0118913_1691_2422 239
127 3300050493 nmdc:mga0k408_10593_c1 nmdc:mga0k408_10593_c1_787_1548 239
128 3300050493 nmdc:mga0k408_82020_c1 nmdc:mga0k408_82020_c1_443_1246 239
129 3300050514 nmdc:mga08x19_1568_c1 nmdc:mga08x19_1568_c1_154_912 239
130 3300050515 nmdc:mga0a205_54574_c1 nmdc:mga0a205_54574_c1_713_1501 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07505

DUF5131

Protein of unknown function (DUF5131)

4

234

0.99

PF17338

GP88

Gene product 88

11

208

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ppc-assembly2.cif.gz_B crystal structure of the candida albicans methionine synthase by surface entropy reduction, tyrosine variant with zinc 0.6424 87 159
1q8j-assembly2.cif.gz_B cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) 0.6281 71 210
7jzb-assembly1.cif.gz_A dihydrodipicolinate synthase s48w with lysine in the allosteric site, and pyruvate and succinic semi-aldehyde 0.604 71 157
7loy-assembly3.cif.gz_D dihydrodipicolinate synthase with pyruvate from candidatus liberibacter solanacearum 0.6025 86 160
4fx8-assembly1.cif.gz_B crystal structure of the mutant q185a.r203a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp 0.6009 71 179
ID Description Score Start End Superfamily
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9673 5 234 3.20.20.70
af_I6YA42_4_243_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9276 5 234 3.20.20.70
1q8jB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.6281 71 210 3.20.20.20
af_K7KXA2_2_94_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.5994 66 130 3.40.50.2000
af_Q54X49_2_443_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.5987 84 213 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A7Y3NW63-F1-model_v4 DUF5131 family protein 0.9964 1 158
AF-A0A7C5IS35-F1-model_v4 DUF5131 family protein 0.9962 4 111
AF-A0A4Q4AJR3-F1-model_v4 deleted 0.9907 4 107
AF-A0A1W9V201-F1-model_v4 Phage Gp37/Gp68 family protein 0.9872 4 165
AF-A0A356GPP7-F1-model_v4 Phage Gp37/Gp68 family protein 0.9871 4 212

Feature Viewer

pLDDT pTM Quality
87.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map