F144382

General Info

Members Datasets Scaffolds Average Seq Length
130 99 260 112

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100543427|Ga0070669_1005434272
Length 117
Sequence MVSIESARRAALALPEAEEKSHFHIPDFRIKNKIFATIHVDKHYMMVKLSLIDQSVFCAYDPAIIFPVPGGWGKKGATFIDLKKIKKQMLIDALTCAWKITAPPKLVEKYFGTDNNV

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
92 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
93 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
94 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
99 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 2.31
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100543427 3300005353 Bacteria 968
2 JGI24751J29686_10002566 3300002459 Bacteria 3649
3 rootH1_10114858 3300003323 Unclassified 1106
4 rootH1_10383150 3300003323 Bacteria 1072
5 Ga0065707_10511007 3300005295 Bacteria 749
6 Ga0070683_100022471 3300005329 Bacteria 5636
7 Ga0070670_100014195 3300005331 Bacteria 6834
8 Ga0070670_100118127 3300005331 Bacteria 2287
9 Ga0068868_101585050 3300005338 Bacteria 615
10 Ga0070661_100324477 3300005344 Bacteria 1203
11 Ga0070671_101370348 3300005355 Bacteria 624
12 Ga0070673_100275994 3300005364 Bacteria 1473
13 Ga0070667_101258355 3300005367 Bacteria 693
14 Ga0070713_102341117 3300005436 Unclassified 517
15 Ga0070678_100735277 3300005456 Unclassified 891
16 Ga0070678_102284367 3300005456 Bacteria 513
17 Ga0070684_100003790 3300005535 Bacteria 11418
18 Ga0068853_100605917 3300005539 Bacteria 1040
19 Ga0068855_100000014 3300005563 Bacteria 232720
20 Ga0070664_100025052 3300005564 Bacteria 4943
21 Ga0068857_102378787 3300005577 Bacteria 520
22 Ga0068856_101952693 3300005614 Bacteria 597
23 Ga0070702_100725119 3300005615 Bacteria 760
24 Ga0068852_100023618 3300005616 Bacteria 4952
25 Ga0068852_100053906 3300005616 Bacteria 3464
26 Ga0068852_100074501 3300005616 Bacteria 2990
27 Ga0068859_100890076 3300005617 Bacteria 975
28 Ga0068851_10000051 3300005834 Bacteria 72304
29 Ga0068851_10086752 3300005834 Bacteria 1642
30 Ga0068851_10156323 3300005834 Bacteria 1250
31 Ga0068863_100069580 3300005841 Bacteria 3327
32 Ga0068858_100195525 3300005842 Bacteria 1911
33 Ga0068860_101154670 3300005843 Bacteria 794
34 Ga0068860_101848060 3300005843 Bacteria 626
35 Ga0068862_100857132 3300005844 Bacteria 891
36 Ga0075366_10514580 3300006195 Bacteria 740
37 Ga0068871_101754766 3300006358 Bacteria 589
38 Ga0068871_101827514 3300006358 Unclassified 577
39 Ga0075428_100612615 3300006844 Bacteria 1162
40 Ga0075430_100581746 3300006846 Bacteria 924
41 Ga0075429_101314386 3300006880 Bacteria 630
42 Ga0097620_100890131 3300006931 Bacteria 975
43 Ga0105240_10765921 3300009093 Unclassified 1048
44 Ga0105240_10950603 3300009093 Bacteria 922
45 Ga0111539_10010577 3300009094 Bacteria 11620
46 Ga0111539_10309645 3300009094 Bacteria 1838
47 Ga0105247_10210611 3300009101 Bacteria 1311
48 Ga0105241_12031996 3300009174 Bacteria 566
49 Ga0105242_10463142 3300009176 Bacteria 1198
50 Ga0105242_12194086 3300009176 Bacteria 597
51 Ga0105239_10000001 3300010375 Bacteria 617353
52 Ga0157373_10005195 3300013100 Bacteria 9780
53 Ga0157371_10191147 3300013102 Bacteria 1466
54 Ga0157370_10266657 3300013104 Unclassified 1582
55 Ga0157374_10109935 3300013296 Bacteria 2651
56 Ga0157374_10441686 3300013296 Bacteria 1302
57 Ga0157374_11931211 3300013296 Bacteria 616
58 Ga0163162_10235785 3300013306 Bacteria 1960
59 Ga0157372_10116209 3300013307 Bacteria 3067
60 Ga0157375_10442752 3300013308 Bacteria 1465
61 Ga0163163_10009660 3300014325 Bacteria 8629
62 Ga0163163_10355857 3300014325 Bacteria 1520
63 Ga0163163_10394663 3300014325 Bacteria 1442
64 Ga0163163_12031646 3300014325 Bacteria 634
65 Ga0163163_12361733 3300014325 Unclassified 590
66 Ga0157380_10030421 3300014326 Bacteria 4135
67 Ga0157380_10047091 3300014326 Bacteria 3389
68 Ga0157380_10346380 3300014326 Bacteria 1388
69 Ga0157380_10352302 3300014326 Bacteria 1378
70 Ga0157380_11848790 3300014326 Bacteria 664
71 Ga0163161_10267432 3300017792 Bacteria 1337
72 Ga0163161_10355066 3300017792 Bacteria 1166
73 Ga0209050_1002374 3300025298 Bacteria 16364
74 Ga0209050_1081752 3300025298 Bacteria 685
75 Ga0209257_1056590 3300025304 Bacteria 1082
76 Ga0207656_10000361 3300025321 Bacteria 15225
77 Ga0207656_10032799 3300025321 Bacteria 2159
78 Ga0207656_10049820 3300025321 Bacteria 1807
79 Ga0207680_10457078 3300025903 Bacteria 907
80 Ga0207654_11135688 3300025911 Bacteria 569
81 Ga0207649_10267826 3300025920 Unclassified 1237
82 Ga0207681_10452266 3300025923 Bacteria 1045
83 Ga0207659_10839331 3300025926 Bacteria 790
84 Ga0207664_10600091 3300025929 Bacteria 989
85 Ga0207704_11847612 3300025938 Bacteria 519
86 Ga0207679_10017916 3300025945 Bacteria 4733
87 Ga0207679_10265915 3300025945 Bacteria 1465
88 Ga0207667_10000049 3300025949 Bacteria 235027
89 Ga0207667_12078102 3300025949 Bacteria 527
90 Ga0207651_10049309 3300025960 Bacteria 2852
91 Ga0207712_11129390 3300025961 Bacteria 698
92 Ga0207677_11382086 3300026023 Bacteria 648
93 Ga0207703_10347373 3300026035 Unclassified 1365
94 Ga0207639_10615426 3300026041 Bacteria 1002
95 Ga0207702_10246903 3300026078 Bacteria 1675
96 Ga0207641_10056699 3300026088 Bacteria 3330
97 Ga0207698_10030507 3300026142 Bacteria 3878
98 Ga0207698_10056211 3300026142 Bacteria 3038
99 Ga0207698_10873577 3300026142 Bacteria 905
100 Ga0209966_1106865 3300027695 Unclassified 635
101 Ga0207428_10027574 3300027907 Bacteria 4728
102 Ga0268265_11102430 3300028380 Bacteria 788
103 Ga0268264_11522966 3300028381 Bacteria 679
104 Ga0307515_10003118 3300028794 Bacteria 35057
105 Ga0265338_10303399 3300028800 Bacteria 1160
106 Ga0265320_10355724 3300031240 Bacteria 647
107 Ga0265327_10042935 3300031251 Bacteria 2424
108 Ga0307513_10267655 3300031456 Bacteria 1494
109 Ga0307514_10062956 3300031649 Bacteria 2819
110 Ga0373925_0720785 3300037068 Unclassified 822
111 Ga0395905_0000001 3300037471 Bacteria 2037079
112 Ga0436365_0816398 3300039437 Unclassified 1305
113 Ga0451807_0109243 3300041486 Bacteria 586
114 Ga0495638_0000040 3300046460 Bacteria 241883
115 Ga0495585_0617694 3300046492 Bacteria 509
116 Ga0495670_0378110 3300046691 Bacteria 764
117 Ga0495672_0030248 3300047320 Unclassified 3401
118 Ga0495686_0001176 3300047472 Bacteria 30528
119 Ga0496108_1169711 3300048911 Unclassified 651
120 Ga0496109_1595544 3300048912 Unclassified 587
121 Ga0501300_007414 3300049523 Bacteria 1609
122 Ga0501217_007246 3300049661 Bacteria 2373
123 Ga0501271_009543 3300049768 Bacteria 1012
124 Ga0501226_007263 3300049853 Bacteria 1243
125 nmdc:mga0k408_476905_c1 3300050493 Bacteria 740
126 nmdc:mga0qj67_730549_c1 3300050509 Bacteria 786
127 nmdc:mga08y16_110525_c1 3300050511 Bacteria 2862
128 nmdc:mga08y16_345061_c1 3300050511 Unclassified 1530
129 Ga0500616_0000013 3300053153 Bacteria 674172
130 Ga0500622_0001051 3300053156 Bacteria 23014
131 Ga0070669_100543427
132 JGI24751J29686_10002566
133 rootH1_10114858
134 rootH1_10383150
135 Ga0065707_10511007
136 Ga0070683_100022471
137 Ga0070670_100014195
138 Ga0070670_100118127
139 Ga0068868_101585050
140 Ga0070661_100324477
141 Ga0070671_101370348
142 Ga0070673_100275994
143 Ga0070667_101258355
144 Ga0070713_102341117
145 Ga0070678_100735277
146 Ga0070678_102284367
147 Ga0070684_100003790
148 Ga0068853_100605917
149 Ga0068855_100000014
150 Ga0070664_100025052
151 Ga0068857_102378787
152 Ga0068856_101952693
153 Ga0070702_100725119
154 Ga0068852_100023618
155 Ga0068852_100053906
156 Ga0068852_100074501
157 Ga0068859_100890076
158 Ga0068851_10000051
159 Ga0068851_10086752
160 Ga0068851_10156323
161 Ga0068863_100069580
162 Ga0068858_100195525
163 Ga0068860_101154670
164 Ga0068860_101848060
165 Ga0068862_100857132
166 Ga0075366_10514580
167 Ga0068871_101754766
168 Ga0068871_101827514
169 Ga0075428_100612615
170 Ga0075430_100581746
171 Ga0075429_101314386
172 Ga0097620_100890131
173 Ga0105240_10765921
174 Ga0105240_10950603
175 Ga0111539_10010577
176 Ga0111539_10309645
177 Ga0105247_10210611
178 Ga0105241_12031996
179 Ga0105242_10463142
180 Ga0105242_12194086
181 Ga0105239_10000001
182 Ga0157373_10005195
183 Ga0157371_10191147
184 Ga0157370_10266657
185 Ga0157374_10109935
186 Ga0157374_10441686
187 Ga0157374_11931211
188 Ga0163162_10235785
189 Ga0157372_10116209
190 Ga0157375_10442752
191 Ga0163163_10009660
192 Ga0163163_10355857
193 Ga0163163_10394663
194 Ga0163163_12031646
195 Ga0163163_12361733
196 Ga0157380_10030421
197 Ga0157380_10047091
198 Ga0157380_10346380
199 Ga0157380_10352302
200 Ga0157380_11848790
201 Ga0163161_10267432
202 Ga0163161_10355066
203 Ga0209050_1002374
204 Ga0209050_1081752
205 Ga0209257_1056590
206 Ga0207656_10000361
207 Ga0207656_10032799
208 Ga0207656_10049820
209 Ga0207680_10457078
210 Ga0207654_11135688
211 Ga0207649_10267826
212 Ga0207681_10452266
213 Ga0207659_10839331
214 Ga0207664_10600091
215 Ga0207704_11847612
216 Ga0207679_10017916
217 Ga0207679_10265915
218 Ga0207667_10000049
219 Ga0207667_12078102
220 Ga0207651_10049309
221 Ga0207712_11129390
222 Ga0207677_11382086
223 Ga0207703_10347373
224 Ga0207639_10615426
225 Ga0207702_10246903
226 Ga0207641_10056699
227 Ga0207698_10030507
228 Ga0207698_10056211
229 Ga0207698_10873577
230 Ga0209966_1106865
231 Ga0207428_10027574
232 Ga0268265_11102430
233 Ga0268264_11522966
234 Ga0307515_10003118
235 Ga0265338_10303399
236 Ga0265320_10355724
237 Ga0265327_10042935
238 Ga0307513_10267655
239 Ga0307514_10062956
240 Ga0373925_0720785
241 Ga0395905_0000001
242 Ga0436365_0816398
243 Ga0451807_0109243
244 Ga0495638_0000040
245 Ga0495585_0617694
246 Ga0495670_0378110
247 Ga0495672_0030248
248 Ga0495686_0001176
249 Ga0496108_1169711
250 Ga0496109_1595544
251 Ga0501300_007414
252 Ga0501217_007246
253 Ga0501271_009543
254 Ga0501226_007263
255 nmdc:mga0k408_476905_c1
256 nmdc:mga0qj67_730549_c1
257 nmdc:mga08y16_110525_c1
258 nmdc:mga08y16_345061_c1
259 Ga0500616_0000013
260 Ga0500622_0001051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

12

100

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n06-assembly1.cif.gz_A crystal structure of cas1 from archaeoglobus fulgidus and its nucleolytic activity 0.8741 16 39
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7639 2 109
5e9u-assembly2.cif.gz_H crystal structure of gtfa/b complex bound to udp and glcnac 0.7637 14 48
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7222 1 110
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7146 2 101
ID Description Score Start End Superfamily
4n06B01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;CRISPR-associated endonuclease Cas1, N-terminal domain 0.8525 16 39 3.100.10.20
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8437 1 101 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8329 5 100 3.90.1150.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.7996 7 108 3.30.70.1230
4tvdA01 Mainly Beta;Ribbon;left handed beta-beta-3-solenoid;Cholin Binding 0.7125 16 36 2.10.270.10
ID Description Score Start End GO Terms
AF-A0A537HRZ8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9991 1 113 GO:0003677
AF-A0A1M7P3A3-F1-model_v4 YjbR protein 0.9981 1 101
AF-A0A7Y3WC20-F1-model_v4 deleted 0.9977 1 101
AF-A0A0X8X523-F1-model_v4 YjbR protein 0.99 1 100
AF-A0A7W1W215-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9889 1 101 GO:0003677

Map