F142675

General Info

Members Datasets Scaffolds Average Seq Length
129 104 258 117

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_1700624|Ga0451807_1700624_103_522
Length 139
Sequence MIRTARMKPTSTDKKPRIYSMSFASVYPMYVQKAARKGRTQEEVDEVIGWLTGYRGAKLAKAIADRRDFEAFFEQAPKLNPHVGLITGVVCGVRIEDLTDPLMQKIRYLDKLVDELAKGRPMEKILRSPDAPPARRAKR

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
101 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
104 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.85
Nodule 0
Rhizoplane 3.88
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_1700624 3300041486 Bacteria 552
2 JGI25159J45721_1001002 3300002987 Bacteria 12179
3 Ga0065165_1000111 3300005262 Bacteria 136009
4 Ga0070658_10000367 3300005327 Bacteria 39376
5 Ga0070683_101243647 3300005329 Bacteria 715
6 Ga0070680_100042997 3300005336 Bacteria 3668
7 Ga0070660_101379296 3300005339 Bacteria 599
8 Ga0070689_101184080 3300005340 Bacteria 685
9 Ga0070674_100364002 3300005356 Bacteria 1172
10 Ga0070681_10284841 3300005458 Bacteria 1563
11 Ga0070679_100099377 3300005530 Bacteria 2897
12 Ga0070693_100706640 3300005547 Bacteria 739
13 Ga0070664_101456386 3300005564 Bacteria 648
14 Ga0068857_100089344 3300005577 Bacteria 2757
15 Ga0068852_100503594 3300005616 Bacteria 1206
16 Ga0068870_10288832 3300005840 Bacteria 1031
17 Ga0075365_10098576 3300006038 Bacteria 1999
18 Ga0075365_10605123 3300006038 Bacteria 775
19 Ga0097621_101051180 3300006237 Unclassified 763
20 Ga0075370_10188444 3300006353 Bacteria 1215
21 Ga0075430_100026034 3300006846 Bacteria 4977
22 Ga0075431_100430002 3300006847 Bacteria 1318
23 Ga0075433_11064075 3300006852 Bacteria 704
24 Ga0075429_100509236 3300006880 Unclassified 1055
25 Ga0111539_13452078 3300009094 Bacteria 508
26 Ga0105239_12281385 3300010375 Bacteria 630
27 Ga0157373_10167845 3300013100 Bacteria 1545
28 Ga0157369_10011250 3300013105 Bacteria 10167
29 Ga0163162_11077965 3300013306 Bacteria 910
30 Ga0163163_10010214 3300014325 Bacteria 8429
31 Ga0163163_13016743 3300014325 Bacteria 525
32 Ga0157380_10805364 3300014326 Bacteria 957
33 Ga0209436_117695 3300025208 Bacteria 1035
34 Ga0209130_1000139 3300025284 Bacteria 115951
35 Ga0209025_1154534 3300025294 Bacteria 629
36 Ga0209050_1036952 3300025298 Bacteria 1417
37 Ga0207426_1065067 3300025302 Bacteria 1035
38 Ga0207682_10114463 3300025893 Bacteria 1190
39 Ga0207647_10000089 3300025904 Bacteria 69909
40 Ga0207643_10961377 3300025908 Bacteria 553
41 Ga0207705_10000018 3300025909 Bacteria 319792
42 Ga0207705_10901055 3300025909 Bacteria 685
43 Ga0207707_10128320 3300025912 Bacteria 2217
44 Ga0207707_10466390 3300025912 Bacteria 1080
45 Ga0207660_11015806 3300025917 Unclassified 676
46 Ga0207657_10141864 3300025919 Bacteria 1962
47 Ga0207652_10479848 3300025921 Bacteria 1120
48 Ga0207681_11403244 3300025923 Unclassified 586
49 Ga0207687_10251260 3300025927 Bacteria 1406
50 Ga0207644_10569999 3300025931 Bacteria 938
51 Ga0207690_10551058 3300025932 Bacteria 937
52 Ga0207690_10931796 3300025932 Bacteria 721
53 Ga0207706_10254203 3300025933 Bacteria 1534
54 Ga0207706_10283958 3300025933 Bacteria 1443
55 Ga0207706_10554954 3300025933 Bacteria 989
56 Ga0207689_10539452 3300025942 Bacteria 979
57 Ga0207667_10822954 3300025949 Bacteria 924
58 Ga0207703_10711557 3300026035 Bacteria 955
59 Ga0207639_10638329 3300026041 Bacteria 984
60 Ga0207674_10021387 3300026116 Bacteria 6967
61 Ga0207675_100259520 3300026118 Bacteria 1684
62 Ga0268264_11840047 3300028381 Bacteria 615
63 Ga0307408_100241274 3300031548 Bacteria 1485
64 Ga0307405_10010783 3300031731 Bacteria 4754
65 Ga0307413_10035986 3300031824 Bacteria 2846
66 Ga0307413_10116338 3300031824 Bacteria 1801
67 Ga0307410_10004434 3300031852 Bacteria 7255
68 Ga0307410_10081852 3300031852 Bacteria 2269
69 Ga0307406_10006138 3300031901 Bacteria 6606
70 Ga0307406_10098408 3300031901 Bacteria 1986
71 Ga0307407_10097356 3300031903 Bacteria 1818
72 Ga0307407_10149368 3300031903 Bacteria 1516
73 Ga0307412_10049233 3300031911 Bacteria 2775
74 Ga0307412_10194961 3300031911 Bacteria 1534
75 Ga0307409_100038454 3300031995 Bacteria 3540
76 Ga0307409_100094049 3300031995 Bacteria 2465
77 Ga0307409_100276504 3300031995 Bacteria 1549
78 Ga0307416_100091514 3300032002 Bacteria 2613
79 Ga0307416_100239342 3300032002 Bacteria 1757
80 Ga0307416_100468440 3300032002 Bacteria 1317
81 Ga0307416_101064607 3300032002 Bacteria 913
82 Ga0307414_10183336 3300032004 Bacteria 1686
83 Ga0307414_10204366 3300032004 Bacteria 1609
84 Ga0307414_10235945 3300032004 Bacteria 1511
85 Ga0307414_10239222 3300032004 Bacteria 1502
86 Ga0307414_10359475 3300032004 Bacteria 1252
87 Ga0307411_10192457 3300032005 Bacteria 1559
88 Ga0307411_10357712 3300032005 Bacteria 1192
89 Ga0307411_10467565 3300032005 Bacteria 1059
90 Ga0307415_100230067 3300032126 Bacteria 1492
91 Ga0451791_0965176 3300041451 Bacteria 1740
92 Ga0451797_0458212 3300041453 Bacteria 979
93 Ga0451795_0107380 3300041456 Bacteria 769
94 Ga0451798_0270822 3300041458 Bacteria 657
95 Ga0451837_0099061 3300041494 Bacteria 843
96 Ga0451845_0404462 3300041501 Bacteria 597
97 Ga0451843_1070409 3300041509 Bacteria 1586
98 Ga0451853_0285269 3300041512 Bacteria 642
99 Ga0450895_011515 3300042132 Bacteria 764
100 Ga0453683_0152311 3300044673 Bacteria 1461
101 Ga0453684_0042792 3300044712 Bacteria 6099
102 Ga0451576_0016406 3300045051 Bacteria 8175
103 Ga0451576_0089870 3300045051 Bacteria 3194
104 Ga0466967_1445917 3300045976 Bacteria 685
105 Ga0501036_0017123 3300049572 Bacteria 6057
106 Ga0501039_0241201 3300049575 Bacteria 1421
107 Ga0501040_0093016 3300049576 Unclassified 2097
108 Ga0501040_0613200 3300049576 Bacteria 786
109 Ga0501042_1087635 3300049578 Bacteria 583
110 Ga0501043_0052322 3300049579 Bacteria 3208
111 Ga0501046_0003731 3300049580 Bacteria 13943
112 Ga0501047_0003600 3300049581 Bacteria 14611
113 Ga0501048_0205448 3300049582 Bacteria 1397
114 Ga0501070_1009434 3300049586 Bacteria 645
115 Ga0501072_0062336 3300049588 Bacteria 2942
116 Ga0501247_017288 3300049677 Bacteria 913
117 Ga0501035_0000115 3300049822 Bacteria 98344
118 Ga0501044_0000027 3300049823 Bacteria 181388
119 nmdc:mga00v17_700606_c1 3300050491 Bacteria 649
120 nmdc:mga0yw44_119502_c1 3300050492 Bacteria 1696
121 nmdc:mga0qj67_48591_c1 3300050509 Unclassified 3352
122 nmdc:mga06r32_217677_c1 3300050510 Bacteria 1897
123 Ga0500573_0423345 3300053140 Bacteria 624
124 Ga0500616_0005801 3300053153 Bacteria 8290
125 Ga0590071_022479 3300059421 Bacteria 1488
126 Ga0590077_036524 3300059426 Bacteria 1084
127 Ga0501082_1295667 3300060353 Bacteria 636
128 2996338370 2996336353 Bacteria 5511628
129 8056879406 8056875544 Bacteria 4355797
130 Ga0451807_1700624
131 JGI25159J45721_1001002
132 Ga0065165_1000111
133 Ga0070658_10000367
134 Ga0070683_101243647
135 Ga0070680_100042997
136 Ga0070660_101379296
137 Ga0070689_101184080
138 Ga0070674_100364002
139 Ga0070681_10284841
140 Ga0070679_100099377
141 Ga0070693_100706640
142 Ga0070664_101456386
143 Ga0068857_100089344
144 Ga0068852_100503594
145 Ga0068870_10288832
146 Ga0075365_10098576
147 Ga0075365_10605123
148 Ga0097621_101051180
149 Ga0075370_10188444
150 Ga0075430_100026034
151 Ga0075431_100430002
152 Ga0075433_11064075
153 Ga0075429_100509236
154 Ga0111539_13452078
155 Ga0105239_12281385
156 Ga0157373_10167845
157 Ga0157369_10011250
158 Ga0163162_11077965
159 Ga0163163_10010214
160 Ga0163163_13016743
161 Ga0157380_10805364
162 Ga0209436_117695
163 Ga0209130_1000139
164 Ga0209025_1154534
165 Ga0209050_1036952
166 Ga0207426_1065067
167 Ga0207682_10114463
168 Ga0207647_10000089
169 Ga0207643_10961377
170 Ga0207705_10000018
171 Ga0207705_10901055
172 Ga0207707_10128320
173 Ga0207707_10466390
174 Ga0207660_11015806
175 Ga0207657_10141864
176 Ga0207652_10479848
177 Ga0207681_11403244
178 Ga0207687_10251260
179 Ga0207644_10569999
180 Ga0207690_10551058
181 Ga0207690_10931796
182 Ga0207706_10254203
183 Ga0207706_10283958
184 Ga0207706_10554954
185 Ga0207689_10539452
186 Ga0207667_10822954
187 Ga0207703_10711557
188 Ga0207639_10638329
189 Ga0207674_10021387
190 Ga0207675_100259520
191 Ga0268264_11840047
192 Ga0307408_100241274
193 Ga0307405_10010783
194 Ga0307413_10035986
195 Ga0307413_10116338
196 Ga0307410_10004434
197 Ga0307410_10081852
198 Ga0307406_10006138
199 Ga0307406_10098408
200 Ga0307407_10097356
201 Ga0307407_10149368
202 Ga0307412_10049233
203 Ga0307412_10194961
204 Ga0307409_100038454
205 Ga0307409_100094049
206 Ga0307409_100276504
207 Ga0307416_100091514
208 Ga0307416_100239342
209 Ga0307416_100468440
210 Ga0307416_101064607
211 Ga0307414_10183336
212 Ga0307414_10204366
213 Ga0307414_10235945
214 Ga0307414_10239222
215 Ga0307414_10359475
216 Ga0307411_10192457
217 Ga0307411_10357712
218 Ga0307411_10467565
219 Ga0307415_100230067
220 Ga0451791_0965176
221 Ga0451797_0458212
222 Ga0451795_0107380
223 Ga0451798_0270822
224 Ga0451837_0099061
225 Ga0451845_0404462
226 Ga0451843_1070409
227 Ga0451853_0285269
228 Ga0450895_011515
229 Ga0453683_0152311
230 Ga0453684_0042792
231 Ga0451576_0016406
232 Ga0451576_0089870
233 Ga0466967_1445917
234 Ga0501036_0017123
235 Ga0501039_0241201
236 Ga0501040_0093016
237 Ga0501040_0613200
238 Ga0501042_1087635
239 Ga0501043_0052322
240 Ga0501046_0003731
241 Ga0501047_0003600
242 Ga0501048_0205448
243 Ga0501070_1009434
244 Ga0501072_0062336
245 Ga0501247_017288
246 Ga0501035_0000115
247 Ga0501044_0000027
248 nmdc:mga00v17_700606_c1
249 nmdc:mga0yw44_119502_c1
250 nmdc:mga0qj67_48591_c1
251 nmdc:mga06r32_217677_c1
252 Ga0500573_0423345
253 Ga0500616_0005801
254 Ga0590071_022479
255 Ga0590077_036524
256 Ga0501082_1295667
257 2996338370
258 8056879406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

17

127

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9325 2 114
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9095 2 114
5cd4-assembly1.cif.gz_C the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.4475 8 113
6q1v-assembly1.cif.gz_A human dna ligase 1 (e592r) bound to an adenylated, hydroxyl terminated dna nick 0.3716 30 114
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.3523 30 113
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.911 2 114 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8812 2 114 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7516 10 114 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7486 9 114 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7272 10 114 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A4Y3MZX0-F1-model_v4 deleted 1.002 3 115
AF-A0A560WHY9-F1-model_v4 DUF2200 family protein 1.002 3 115
AF-A0A3A5WPL9-F1-model_v4 DUF2200 domain-containing protein 1.002 1 107
AF-A0A7Y7HHU7-F1-model_v4 deleted 1.001 1 115
AF-A0A6I3JA20-F1-model_v4 DUF2200 family protein 1.001 4 115

Map