F142669

General Info

Members Datasets Scaffolds Average Seq Length
129 97 258 235

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0004517|Ga0439465_0004517_2250_3011
Length 253
Sequence MSQRPFLLSPDPEAPFPPAELALRQPDGLLAVGGDLSASRLLNAYRHGIFPWYTAGQPILWWSPDPRMVFRTEGVRLSSRFRRELTRSSWWATADTAFADVIRACAQSPRPGQQGTWITEEMQAAYLELHTLGHAHSVEVFEATGSGQKRLVGGIYGVAIGRMFFGESMFSAVSGGSKVALAALAHRLREWGWPLIDAQVENDHLLSLGAERWPRAKFLGQVAEHVERDGNPGSWSERFGQMPTSLLSLVNQN

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
46 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
47 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
48 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
54 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
58 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
59 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
60 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
61 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
68 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
72 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
81 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
82 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
86 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
87 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
88 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
89 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
90 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
91 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
92 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
93 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
94 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
95 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
96 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
97 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.92
Metatranscriptomes 0.78
Isolates 9.3

Biome Distribution

Category Percentage (%)
Aerial Root 1.55
Bulb 0
Endosphere 24.03
Nodule 0
Rhizoplane 3.1
Rhizosphere 63.57
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0004517 3300041413 Bacteria 4499
2 JGI25151J46595_10037138 3300003187 Bacteria 1829
3 rootH1_10225827 3300003323 Bacteria 2124
4 Ga0055526_1006208 3300003771 Bacteria 6561
5 Ga0055524_1020130 3300003775 Bacteria 2258
6 Ga0055524_1028447 3300003775 Bacteria 1674
7 Ga0055536_1011205 3300003781 Bacteria 3468
8 Ga0055536_1026210 3300003781 Bacteria 1640
9 Ga0055530_10000993 3300003791 Bacteria 22741
10 Ga0055531_10017623 3300003794 Bacteria 3002
11 Ga0055531_10023404 3300003794 Bacteria 2318
12 Ga0055531_10023499 3300003794 Bacteria 2308
13 Ga0055531_10053502 3300003794 Bacteria 1042
14 Ga0068869_100018459 3300005334 Unclassified 4748
15 Ga0070668_100043952 3300005347 Bacteria 3426
16 Ga0070673_100546265 3300005364 Unclassified 1052
17 Ga0068852_100378987 3300005616 Bacteria 1387
18 Ga0068859_100003163 3300005617 Bacteria 16740
19 Ga0068860_100005157 3300005843 Bacteria 13283
20 Ga0068871_100519225 3300006358 Bacteria 1075
21 Ga0105244_10157761 3300009036 Bacteria 1085
22 Ga0105240_10000040 3300009093 Bacteria 264634
23 Ga0105241_10024422 3300009174 Bacteria 4487
24 Ga0105237_10320115 3300009545 Bacteria 1554
25 Ga0105249_10019805 3300009553 Bacteria 6006
26 Ga0105028_112095 3300009993 Bacteria 911
27 Ga0105239_10000557 3300010375 Bacteria 53486
28 Ga0105239_10102467 3300010375 Bacteria 3168
29 Ga0157371_10000086 3300013102 Bacteria 146397
30 Ga0157371_10023305 3300013102 Bacteria 4527
31 Ga0157371_10159445 3300013102 Bacteria 1611
32 Ga0157371_10203074 3300013102 Bacteria 1421
33 Ga0157370_11039546 3300013104 Unclassified 741
34 Ga0157369_10073057 3300013105 Bacteria 3680
35 Ga0157374_10250165 3300013296 Bacteria 1744
36 Ga0157378_10698559 3300013297 Bacteria 1033
37 Ga0163162_10000972 3300013306 Bacteria 26646
38 Ga0157372_10135197 3300013307 Bacteria 2839
39 Ga0157372_10286621 3300013307 Bacteria 1915
40 Ga0157372_10917604 3300013307 Bacteria 1016
41 Ga0157372_10984963 3300013307 Bacteria 977
42 Ga0209673_1040387 3300025273 Bacteria 1335
43 Ga0209675_1023913 3300025291 Bacteria 1571
44 Ga0209676_1000196 3300025292 Bacteria 135726
45 Ga0209676_1001629 3300025292 Bacteria 19852
46 Ga0209676_1008887 3300025292 Bacteria 4416
47 Ga0209676_1011670 3300025292 Bacteria 3521
48 Ga0209676_1014388 3300025292 Bacteria 2978
49 Ga0209676_1030701 3300025292 Bacteria 1639
50 Ga0209676_1037710 3300025292 Bacteria 1391
51 Ga0209025_1014462 3300025294 Bacteria 4849
52 Ga0209025_1023542 3300025294 Bacteria 3212
53 Ga0209564_1010750 3300025295 Bacteria 4177
54 Ga0209758_1067848 3300025297 Bacteria 1139
55 Ga0209050_1030518 3300025298 Bacteria 1700
56 Ga0209256_1002315 3300025299 Bacteria 15953
57 Ga0209256_1007155 3300025299 Bacteria 5616
58 Ga0209256_1013052 3300025299 Bacteria 3114
59 Ga0209257_1000065 3300025304 Bacteria 353604
60 Ga0209257_1000238 3300025304 Bacteria 128576
61 Ga0209257_1012465 3300025304 Bacteria 3923
62 Ga0207655_1115610 3300025728 Bacteria 898
63 Ga0207695_10000041 3300025913 Bacteria 450902
64 Ga0207712_10337776 3300025961 Bacteria 1248
65 Ga0209371_1020170 3300027312 Bacteria 1647
66 Ga0268264_10006312 3300028381 Bacteria 9993
67 Ga0307515_10000001 3300028794 Bacteria 4259510
68 Ga0268256_1021832 3300030500 Bacteria 1693
69 Ga0316177_1099858 3300030731 Unclassified 883
70 Ga0316575_10096579 3300031665 Bacteria 1199
71 Ga0316579_10003182 3300031691 Bacteria 6354
72 Ga0316579_10011616 3300031691 Bacteria 3746
73 Ga0316576_10044336 3300031727 Bacteria 3212
74 Ga0316577_10008890 3300031733 Bacteria 5391
75 Ga0307412_10026720 3300031911 Bacteria 3591
76 Ga0307412_10225642 3300031911 Bacteria 1439
77 Ga0316583_10000688 3300032133 Bacteria 10401
78 Ga0316580_10017732 3300032139 Bacteria 2190
79 Ga0316580_10044370 3300032139 Bacteria 1372
80 Ga0316593_10003017 3300032168 Bacteria 4103
81 Ga0316574_0022098 3300035398 Bacteria 3786
82 Ga0316574_0056264 3300035398 Bacteria 2460
83 Ga0316582_0001407 3300036647 Bacteria 10499
84 Ga0316581_0069413 3300037588 Unclassified 1082
85 Ga0439436_0030802 3300041404 Bacteria 1558
86 Ga0439465_0027629 3300041413 Bacteria 1797
87 Ga0451791_1798793 3300041451 Bacteria 1009
88 Ga0451795_1104590 3300041456 Bacteria 1557
89 Ga0439445_0014685 3300042004 Bacteria 1910
90 Ga0439449_0001458 3300042007 Bacteria 9259
91 Ga0439449_0036731 3300042007 Bacteria 1822
92 Ga0451577_0844079 3300042876 Bacteria 826
93 Ga0453683_0183534 3300044673 Bacteria 1327
94 Ga0453684_0062827 3300044712 Bacteria 4754
95 Ga0453684_0514036 3300044712 Bacteria 1324
96 Ga0495638_0048666 3300046460 Bacteria 2653
97 Ga0495663_0000202 3300046525 Bacteria 23728
98 Ga0496102_0364562 3300048905 Bacteria 1360
99 Ga0496107_0240861 3300048910 Bacteria 1346
100 Ga0496122_0042187 3300048925 Bacteria 3593
101 Ga0496123_0047431 3300048926 Bacteria 2903
102 Ga0496124_0181184 3300048927 Bacteria 1621
103 Ga0501033_0297496 3300049570 Bacteria 1137
104 Ga0501034_0315417 3300049571 Unclassified 1497
105 Ga0501047_0015309 3300049581 Bacteria 7307
106 Ga0501067_0133437 3300049583 Bacteria 1382
107 Ga0501070_0002736 3300049586 Bacteria 15392
108 Ga0501070_0297381 3300049586 Unclassified 1315
109 Ga0501073_0017837 3300049589 Bacteria 5137
110 Ga0501074_0046283 3300049590 Bacteria 3146
111 Ga0501074_0116522 3300049590 Bacteria 1911
112 Ga0501077_0220033 3300049593 Bacteria 1207
113 Ga0501240_000723 3300049673 Bacteria 2888
114 Ga0501225_0001447 3300049705 Bacteria 7427
115 Ga0501080_0073125 3300049742 Bacteria 3189
116 nmdc:mga0qj67_108763_c1 3300050509 Bacteria 2237
117 Ga0501084_0058353 3300054114 Bacteria 3229
118 2510284961 2510065053 Bacteria 5005518
119 2510294207 2510065055 Bacteria 5037935
120 2510313234 2510065058 Bacteria 5005894
121 2748017961 2747842501 Bacteria 5293829
122 2774128073 2773857672 Bacteria 4993178
123 2917835583 2917832318 Bacteria 5346010
124 2919129653 2919125081 Bacteria 5385106
125 2974299778 2974298342 Bacteria 4840922
126 2984502147 2984499530 Bacteria 5020881
127 2984504337 2984504281 Bacteria 5262371
128 8003015886 8003014200 Bacteria 4059994
129 8016728435 8016728285 Bacteria 5263933
130 Ga0439465_0004517
131 JGI25151J46595_10037138
132 rootH1_10225827
133 Ga0055526_1006208
134 Ga0055524_1020130
135 Ga0055524_1028447
136 Ga0055536_1011205
137 Ga0055536_1026210
138 Ga0055530_10000993
139 Ga0055531_10017623
140 Ga0055531_10023404
141 Ga0055531_10023499
142 Ga0055531_10053502
143 Ga0068869_100018459
144 Ga0070668_100043952
145 Ga0070673_100546265
146 Ga0068852_100378987
147 Ga0068859_100003163
148 Ga0068860_100005157
149 Ga0068871_100519225
150 Ga0105244_10157761
151 Ga0105240_10000040
152 Ga0105241_10024422
153 Ga0105237_10320115
154 Ga0105249_10019805
155 Ga0105028_112095
156 Ga0105239_10000557
157 Ga0105239_10102467
158 Ga0157371_10000086
159 Ga0157371_10023305
160 Ga0157371_10159445
161 Ga0157371_10203074
162 Ga0157370_11039546
163 Ga0157369_10073057
164 Ga0157374_10250165
165 Ga0157378_10698559
166 Ga0163162_10000972
167 Ga0157372_10135197
168 Ga0157372_10286621
169 Ga0157372_10917604
170 Ga0157372_10984963
171 Ga0209673_1040387
172 Ga0209675_1023913
173 Ga0209676_1000196
174 Ga0209676_1001629
175 Ga0209676_1008887
176 Ga0209676_1011670
177 Ga0209676_1014388
178 Ga0209676_1030701
179 Ga0209676_1037710
180 Ga0209025_1014462
181 Ga0209025_1023542
182 Ga0209564_1010750
183 Ga0209758_1067848
184 Ga0209050_1030518
185 Ga0209256_1002315
186 Ga0209256_1007155
187 Ga0209256_1013052
188 Ga0209257_1000065
189 Ga0209257_1000238
190 Ga0209257_1012465
191 Ga0207655_1115610
192 Ga0207695_10000041
193 Ga0207712_10337776
194 Ga0209371_1020170
195 Ga0268264_10006312
196 Ga0307515_10000001
197 Ga0268256_1021832
198 Ga0316177_1099858
199 Ga0316575_10096579
200 Ga0316579_10003182
201 Ga0316579_10011616
202 Ga0316576_10044336
203 Ga0316577_10008890
204 Ga0307412_10026720
205 Ga0307412_10225642
206 Ga0316583_10000688
207 Ga0316580_10017732
208 Ga0316580_10044370
209 Ga0316593_10003017
210 Ga0316574_0022098
211 Ga0316574_0056264
212 Ga0316582_0001407
213 Ga0316581_0069413
214 Ga0439436_0030802
215 Ga0439465_0027629
216 Ga0451791_1798793
217 Ga0451795_1104590
218 Ga0439445_0014685
219 Ga0439449_0001458
220 Ga0439449_0036731
221 Ga0451577_0844079
222 Ga0453683_0183534
223 Ga0453684_0062827
224 Ga0453684_0514036
225 Ga0495638_0048666
226 Ga0495663_0000202
227 Ga0496102_0364562
228 Ga0496107_0240861
229 Ga0496122_0042187
230 Ga0496123_0047431
231 Ga0496124_0181184
232 Ga0501033_0297496
233 Ga0501034_0315417
234 Ga0501047_0015309
235 Ga0501067_0133437
236 Ga0501070_0002736
237 Ga0501070_0297381
238 Ga0501073_0017837
239 Ga0501074_0046283
240 Ga0501074_0116522
241 Ga0501077_0220033
242 Ga0501240_000723
243 Ga0501225_0001447
244 Ga0501080_0073125
245 nmdc:mga0qj67_108763_c1
246 Ga0501084_0058353
247 2510284961
248 2510294207
249 2510313234
250 2748017961
251 2774128073
252 2917835583
253 2919129653
254 2974299778
255 2984502147
256 2984504337
257 8003015886
258 8016728435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

38

214

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.9711 6 226
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9678 4 226
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9655 5 226
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9621 6 226
2z3n-assembly1.cif.gz_B complex structure of lf-transferase and peptide b 0.9494 6 226
ID Description Score Start End Superfamily
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9609 6 64 3.30.70.3550
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9496 4 64 3.30.70.3550
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9479 65 226 3.40.630.70
2z3lB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9345 4 64 3.30.70.3550
2dpsB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Leucyl/phenylalanyl-tRNA-protein transferase, N-terminal domain 0.9006 6 64 3.30.70.3550
ID Description Score Start End GO Terms
AF-A0A518N0Z5-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9932 4 243 GO:0005737
GO:0008914
GO:0030163
AF-A0A2N1WJ52-F1-model_v4 deleted 0.9912 4 144
AF-A0A7T8MQG1-F1-model_v4 deleted 0.9898 4 245
AF-A0A2M7WP89-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9896 14 217 GO:0005737
GO:0008914
GO:0030163
AF-A0A7Y1V5H8-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9874 14 222 GO:0005737
GO:0008914
GO:0030163

Map