F142629

General Info

Members Datasets Scaffolds Average Seq Length
129 35 258 271

Family's Representative Sequence

Representative Sequence 3300039093|Ga0400489_71401|Ga0400489_71401_32_934
Length 300
Sequence MDHRGRDITIKGILEKTLWRIDMTVVRALILTGYGLNCDYETDYSFKVAGAESHRVHINELISREGFFPETGLSHYHILVFGGGFSWADDHGAGVLLASKLRFNIGEEIQRFIQDGKLVIGICNGFQSLVNLGLLPGFEGNYNERRVALTYNDSGNFTDSWVNLSIPDNTPCVFTKGIKHIELPVRHGEGKFYASQENIERLLQNNQVVVQYADSEGLPAKGKWPENPNGSLNDIAGICDPTGRIFGLMPHPEAFHHFTNHPNWTMKKEVLIREGKSIDNQEGDGIQIFRNAVDYIRDSF

Samples

Sample ID Description Type Environment
1 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
2 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
3 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
4 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
5 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
6 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
7 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
8 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
9 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
10 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
11 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
12 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
13 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
14 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
15 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
16 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
17 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
18 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
19 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
20 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
21 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
22 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
23 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
24 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
25 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
26 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
27 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
28 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
29 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
30 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
31 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
32 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
33 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
34 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
35 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400489_71401 3300039093 Bacteria 1083
2 Ga0075428_100076046 3300006844 Bacteria 3666
3 Ga0265330_10079142 3300031235 Bacteria 1417
4 Ga0265320_10135314 3300031240 Bacteria 1118
5 Ga0265329_10039926 3300031242 Bacteria 1507
6 Ga0265316_10008171 3300031344 Bacteria 9737
7 Ga0265316_10045457 3300031344 Bacteria 3484
8 Ga0316575_10001594 3300031665 Bacteria 7386
9 Ga0316575_10008892 3300031665 Bacteria 3667
10 Ga0316575_10015635 3300031665 Bacteria 2862
11 Ga0316579_10017220 3300031691 Unclassified 3167
12 Ga0316579_10032267 3300031691 Bacteria 2402
13 Ga0316579_10047128 3300031691 Bacteria 2012
14 Ga0316579_10052521 3300031691 Bacteria 1908
15 Ga0316579_10055855 3300031691 Bacteria 1852
16 Ga0265342_10004227 3300031712 Bacteria 11395
17 Ga0265342_10122593 3300031712 Bacteria 1462
18 Ga0316576_10002139 3300031727 Bacteria 11131
19 Ga0316576_10007119 3300031727 Bacteria 7014
20 Ga0316576_10007872 3300031727 Bacteria 6740
21 Ga0316576_10014749 3300031727 Bacteria 5225
22 Ga0316576_10022823 3300031727 Bacteria 4351
23 Ga0316576_10062096 3300031727 Bacteria 2739
24 Ga0316576_10099133 3300031727 Bacteria 2176
25 Ga0316576_10178069 3300031727 Bacteria 1604
26 Ga0316576_10266239 3300031727 Bacteria 1285
27 Ga0316576_10529593 3300031727 Bacteria 865
28 Ga0316578_10004085 3300031728 Bacteria 6824
29 Ga0316578_10006836 3300031728 Bacteria 5663
30 Ga0316578_10009540 3300031728 Bacteria 4994
31 Ga0316578_10044074 3300031728 Bacteria 2593
32 Ga0316578_10137190 3300031728 Unclassified 1473
33 Ga0316578_10244644 3300031728 Bacteria 1077
34 Ga0316577_10011159 3300031733 Bacteria 4863
35 Ga0316577_10023407 3300031733 Bacteria 3430
36 Ga0316577_10041337 3300031733 Bacteria 2579
37 Ga0316577_10051672 3300031733 Bacteria 2293
38 Ga0316577_10058004 3300031733 Bacteria 2161
39 Ga0316577_10100256 3300031733 Bacteria 1623
40 Ga0316577_10150581 3300031733 Unclassified 1311
41 Ga0316583_10000347 3300032133 Bacteria 13257
42 Ga0316583_10007417 3300032133 Bacteria 3948
43 Ga0316583_10017943 3300032133 Unclassified 2542
44 Ga0316583_10026813 3300032133 Bacteria 2056
45 Ga0316583_10067610 3300032133 Bacteria 1250
46 Ga0316583_10084802 3300032133 Bacteria 1106
47 Ga0316585_10004828 3300032137 Bacteria 3780
48 Ga0316585_10005917 3300032137 Bacteria 3473
49 Ga0316585_10006970 3300032137 Bacteria 3244
50 Ga0316585_10063589 3300032137 Bacteria 1194
51 Ga0316580_10003348 3300032139 Bacteria 4540
52 Ga0316580_10039460 3300032139 Bacteria 1459
53 Ga0316574_0001384 3300035398 Bacteria 11456
54 Ga0316574_0038105 3300035398 Bacteria 2950
55 Ga0316574_0056450 3300035398 Bacteria 2457
56 Ga0316574_0097054 3300035398 Bacteria 1883
57 Ga0316574_0144753 3300035398 Bacteria 1531
58 Ga0316582_0001225 3300036647 Bacteria 11049
59 Ga0316582_0025106 3300036647 Bacteria 3574
60 Ga0316582_0029961 3300036647 Bacteria 3310
61 Ga0316582_0034818 3300036647 Bacteria 3104
62 Ga0316582_0049760 3300036647 Unclassified 2652
63 Ga0316582_0067005 3300036647 Bacteria 2315
64 Ga0316582_0189723 3300036647 Bacteria 1400
65 Ga0316582_0264007 3300036647 Unclassified 1181
66 Ga0316582_0282289 3300036647 Unclassified 1140
67 Ga0316582_0350924 3300036647 Unclassified 1015
68 Ga0316582_0592006 3300036647 Unclassified 764
69 Ga0316584_0002816 3300036712 Bacteria 11148
70 Ga0316584_0009933 3300036712 Bacteria 6629
71 Ga0316584_0011539 3300036712 Bacteria 6212
72 Ga0316584_0034343 3300036712 Bacteria 3760
73 Ga0316584_0056013 3300036712 Bacteria 2951
74 Ga0316584_0068563 3300036712 Bacteria 2658
75 Ga0316584_0083356 3300036712 Bacteria 2395
76 Ga0316584_0126958 3300036712 Bacteria 1905
77 Ga0316584_0139408 3300036712 Unclassified 1810
78 Ga0316584_0182790 3300036712 Bacteria 1552
79 Ga0316584_0199389 3300036712 Bacteria 1477
80 Ga0316584_0207162 3300036712 Unclassified 1445
81 Ga0395905_0016832 3300037471 Bacteria 6946
82 Ga0316581_0054917 3300037588 Unclassified 1221
83 Ga0316581_0071105 3300037588 Bacteria 1069
84 Ga0400484_15626 3300038725 Bacteria 1753
85 Ga0400484_21940 3300038725 Bacteria 2187
86 Ga0400484_29554 3300038725 Bacteria 1311
87 Ga0400490_04711 3300038726 Bacteria 111545
88 Ga0400490_28311 3300038726 Bacteria 3510
89 Ga0400490_51023 3300038726 Bacteria 6624
90 Ga0400491_00029 3300038727 Bacteria 2569
91 Ga0400491_06000 3300038727 Bacteria 2503
92 Ga0400491_11939 3300038727 Bacteria 4523
93 Ga0400485_18096 3300038735 Bacteria 17133
94 Ga0400485_19017 3300038735 Bacteria 1548
95 Ga0400485_21048 3300038735 Bacteria 29568
96 Ga0400488_09690 3300038741 Bacteria 2091
97 Ga0400488_12024 3300038741 Unclassified 1691
98 Ga0400488_28511 3300038741 Bacteria 9538
99 Ga0400488_54379 3300038741 Bacteria 8029
100 Ga0400486_00558 3300038742 Bacteria 86624
101 Ga0400486_04784 3300038742 Bacteria 42272
102 Ga0400486_11909 3300038742 Bacteria 9885
103 Ga0400486_33030 3300038742 Bacteria 5245
104 Ga0400483_006546 3300039062 Bacteria 4246
105 Ga0400483_028222 3300039062 Bacteria 2355
106 Ga0400483_065403 3300039062 Bacteria 2991
107 Ga0400483_143069 3300039062 Bacteria 1631
108 Ga0400483_145650 3300039062 Bacteria 9345
109 Ga0400483_205120 3300039062 Bacteria 1966
110 Ga0400483_232414 3300039062 Bacteria 1667
111 Ga0400489_03198 3300039093 Bacteria 5472
112 Ga0400489_13722 3300039093 Bacteria 33174
113 Ga0400489_39565 3300039093 Bacteria 11733
114 Ga0400489_71101 3300039093 Bacteria 95670
115 Ga0400489_89934 3300039093 Bacteria 64123
116 Ga0400487_15874 3300039110 Bacteria 40030
117 Ga0400487_40056 3300039110 Bacteria 2441
118 Ga0451577_0006923 3300042876 Bacteria 11209
119 Ga0451577_0022731 3300042876 Bacteria 5725
120 Ga0451577_0069201 3300042876 Bacteria 3147
121 Ga0451577_0075163 3300042876 Bacteria 3013
122 Ga0453684_0000022 3300044712 Bacteria 860785
123 Ga0453684_0015440 3300044712 Bacteria 12078
124 Ga0453684_0094460 3300044712 Bacteria 3679
125 Ga0451576_0000704 3300045051 Bacteria 67767
126 Ga0495636_0002038 3300047318 Bacteria 7747
127 Ga0501034_0348461 3300049571 Bacteria 1410
128 Ga0501070_0211463 3300049586 Bacteria 1592
129 2740991842 2740891818 Bacteria 6711283
130 Ga0400489_71401
131 Ga0075428_100076046
132 Ga0265330_10079142
133 Ga0265320_10135314
134 Ga0265329_10039926
135 Ga0265316_10008171
136 Ga0265316_10045457
137 Ga0316575_10001594
138 Ga0316575_10008892
139 Ga0316575_10015635
140 Ga0316579_10017220
141 Ga0316579_10032267
142 Ga0316579_10047128
143 Ga0316579_10052521
144 Ga0316579_10055855
145 Ga0265342_10004227
146 Ga0265342_10122593
147 Ga0316576_10002139
148 Ga0316576_10007119
149 Ga0316576_10007872
150 Ga0316576_10014749
151 Ga0316576_10022823
152 Ga0316576_10062096
153 Ga0316576_10099133
154 Ga0316576_10178069
155 Ga0316576_10266239
156 Ga0316576_10529593
157 Ga0316578_10004085
158 Ga0316578_10006836
159 Ga0316578_10009540
160 Ga0316578_10044074
161 Ga0316578_10137190
162 Ga0316578_10244644
163 Ga0316577_10011159
164 Ga0316577_10023407
165 Ga0316577_10041337
166 Ga0316577_10051672
167 Ga0316577_10058004
168 Ga0316577_10100256
169 Ga0316577_10150581
170 Ga0316583_10000347
171 Ga0316583_10007417
172 Ga0316583_10017943
173 Ga0316583_10026813
174 Ga0316583_10067610
175 Ga0316583_10084802
176 Ga0316585_10004828
177 Ga0316585_10005917
178 Ga0316585_10006970
179 Ga0316585_10063589
180 Ga0316580_10003348
181 Ga0316580_10039460
182 Ga0316574_0001384
183 Ga0316574_0038105
184 Ga0316574_0056450
185 Ga0316574_0097054
186 Ga0316574_0144753
187 Ga0316582_0001225
188 Ga0316582_0025106
189 Ga0316582_0029961
190 Ga0316582_0034818
191 Ga0316582_0049760
192 Ga0316582_0067005
193 Ga0316582_0189723
194 Ga0316582_0264007
195 Ga0316582_0282289
196 Ga0316582_0350924
197 Ga0316582_0592006
198 Ga0316584_0002816
199 Ga0316584_0009933
200 Ga0316584_0011539
201 Ga0316584_0034343
202 Ga0316584_0056013
203 Ga0316584_0068563
204 Ga0316584_0083356
205 Ga0316584_0126958
206 Ga0316584_0139408
207 Ga0316584_0182790
208 Ga0316584_0199389
209 Ga0316584_0207162
210 Ga0395905_0016832
211 Ga0316581_0054917
212 Ga0316581_0071105
213 Ga0400484_15626
214 Ga0400484_21940
215 Ga0400484_29554
216 Ga0400490_04711
217 Ga0400490_28311
218 Ga0400490_51023
219 Ga0400491_00029
220 Ga0400491_06000
221 Ga0400491_11939
222 Ga0400485_18096
223 Ga0400485_19017
224 Ga0400485_21048
225 Ga0400488_09690
226 Ga0400488_12024
227 Ga0400488_28511
228 Ga0400488_54379
229 Ga0400486_00558
230 Ga0400486_04784
231 Ga0400486_11909
232 Ga0400486_33030
233 Ga0400483_006546
234 Ga0400483_028222
235 Ga0400483_065403
236 Ga0400483_143069
237 Ga0400483_145650
238 Ga0400483_205120
239 Ga0400483_232414
240 Ga0400489_03198
241 Ga0400489_13722
242 Ga0400489_39565
243 Ga0400489_71101
244 Ga0400489_89934
245 Ga0400487_15874
246 Ga0400487_40056
247 Ga0451577_0006923
248 Ga0451577_0022731
249 Ga0451577_0069201
250 Ga0451577_0075163
251 Ga0453684_0000022
252 Ga0453684_0015440
253 Ga0453684_0094460
254 Ga0451576_0000704
255 Ga0495636_0002038
256 Ga0501034_0348461
257 Ga0501070_0211463
258 2740991842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

25

296

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8446 3 258
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.8431 3 257
6jt7-assembly1.cif.gz_A crystal structure of 452-453_deletion mutant of fgam synthetase 0.8424 3 257
6lyo-assembly1.cif.gz_A crystal structure of h296a mutant of formylglycinamidine synthetase 0.8419 3 257
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.8412 3 257
ID Description Score Start End Superfamily
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8815 3 259 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8788 5 260 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8725 5 260 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8703 3 259 3.40.50.880
af_P35421_1030_1350_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8702 3 259 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A660VHG5-F1-model_v4 Phosphoribosylformylglycinamidine synthase 0.956 4 217 GO:0004642
GO:0005737
GO:0006189
AF-A0A0F9KEI3-F1-model_v4 Uncharacterized protein 0.9512 3 111 GO:0004642
GO:0005737
GO:0006164
AF-A0A660VHG5-F1-model_v4 Phosphoribosylformylglycinamidine synthase 0.9473 4 217 GO:0004642
GO:0005737
GO:0006189
AF-A0A7X9HF54-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9438 1 223 GO:0004642
GO:0005737
GO:0006189
AF-T0RR74-F1-model_v4 CobB/CobQ-like glutamine amidotransferase domain protein 0.9413 3 78 GO:0016740

Map