F142427

General Info

Members Datasets Scaffolds Average Seq Length
129 93 127 265

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100002601|Ga0307409_1000026019
Length 301
Sequence MRPRTLVLRTAGTNCDVETAHAFELAGASARRVHLNRVLENPRLLGDFQILAIPGGFSYGDDIAAGRIFANQITRRLRDAVRAFVDAGKPVIGVCNGFQVLVKTDLLPGPIGGREGQTCTLAHNDCGRFIDRWIRVSPRSSKCVWTQGLSQGSGFRVQGSAKPAETPLAASSSFPEPRTLSPKALIELAIAHGEGKFVPADESVRRALWDEDRVALVYVRPDGSAANGEAPDNPNGSVDDIAGVCDASGLVFGLMPHPERHVTPLQHPAWTRRQPLPAEGAGLAMFRNAVRHAAAGVGAGV

Samples

Sample ID Description Type Environment
1 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
2 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100100980 3300005331 Bacteria 2484
2 Ga0070666_10246033 3300005335 Bacteria 1265
3 Ga0068868_100281266 3300005338 Bacteria 1408
4 Ga0070668_100083001 3300005347 Bacteria 2515
5 Ga0070668_100470878 3300005347 Bacteria 1083
6 Ga0070669_100211143 3300005353 Bacteria 1531
7 Ga0070675_100014362 3300005354 Bacteria 6244
8 Ga0070675_100018123 3300005354 Bacteria 5604
9 Ga0070671_100304883 3300005355 Bacteria 1356
10 Ga0070671_100418280 3300005355 Bacteria 1148
11 Ga0070659_100026126 3300005366 Bacteria 4491
12 Ga0070667_100078349 3300005367 Bacteria 2823
13 Ga0070714_100151360 3300005435 Bacteria 2091
14 Ga0070713_100233899 3300005436 Unclassified 1671
15 Ga0070713_100393426 3300005436 Unclassified 1293
16 Ga0070710_10059649 3300005437 Unclassified 2168
17 Ga0070662_100089169 3300005457 Bacteria 2313
18 Ga0070685_10148972 3300005466 Bacteria 1481
19 Ga0070706_100205151 3300005467 Bacteria 1841
20 Ga0068853_100021247 3300005539 Bacteria 5408
21 Ga0070672_100083950 3300005543 Bacteria 2557
22 Ga0070665_100000930 3300005548 Bacteria 37459
23 Ga0070665_100288946 3300005548 Bacteria 1642
24 Ga0068855_100112171 3300005563 Bacteria 3129
25 Ga0068855_100121289 3300005563 Bacteria 2992
26 Ga0070664_100091547 3300005564 Bacteria 2632
27 Ga0068857_100027229 3300005577 Bacteria 5041
28 Ga0068852_100283461 3300005616 Bacteria 1598
29 Ga0068860_100173175 3300005843 Bacteria 2085
30 Ga0068860_100264549 3300005843 Bacteria 1677
31 Ga0068860_100663328 3300005843 Bacteria 1051
32 Ga0068871_100702559 3300006358 Unclassified 926
33 Ga0068871_100793638 3300006358 Bacteria 872
34 Ga0075428_100035801 3300006844 Bacteria 5471
35 Ga0075429_100544453 3300006880 Unclassified 1017
36 Ga0105241_10071348 3300009174 Bacteria 2696
37 Ga0105248_10157006 3300009177 Bacteria 2567
38 Ga0105248_10496804 3300009177 Unclassified 1375
39 Ga0105237_10173449 3300009545 Bacteria 2157
40 Ga0105237_10415872 3300009545 Bacteria 1350
41 Ga0105239_10017429 3300010375 Bacteria 7944
42 Ga0157373_10065646 3300013100 Bacteria 2568
43 Ga0157371_10064613 3300013102 Bacteria 2593
44 Ga0157371_10087039 3300013102 Bacteria 2212
45 Ga0157371_10152319 3300013102 Bacteria 1649
46 Ga0157369_10071227 3300013105 Bacteria 3732
47 Ga0157369_10288313 3300013105 Bacteria 1709
48 Ga0163162_10719367 3300013306 Bacteria 1119
49 Ga0157372_10032858 3300013307 Bacteria 5693
50 Ga0157372_10094328 3300013307 Bacteria 3407
51 Ga0157372_10152081 3300013307 Bacteria 2671
52 Ga0157372_11183982 3300013307 Archaea 883
53 Ga0163163_11204376 3300014325 Unclassified 820
54 Ga0207680_10206589 3300025903 Bacteria 1341
55 Ga0207705_10002669 3300025909 Bacteria 13670
56 Ga0207684_10250529 3300025910 Bacteria 1528
57 Ga0207650_10069640 3300025925 Bacteria 2643
58 Ga0207659_10174672 3300025926 Bacteria 1697
59 Ga0207700_10344757 3300025928 Unclassified 1296
60 Ga0207644_10039669 3300025931 Bacteria 3325
61 Ga0207669_10451852 3300025937 Bacteria 1018
62 Ga0207691_10069550 3300025940 Bacteria 3180
63 Ga0207711_10254320 3300025941 Unclassified 1614
64 Ga0207667_10190995 3300025949 Bacteria 2101
65 Ga0207658_10057197 3300025986 Bacteria 2897
66 Ga0207639_10053791 3300026041 Bacteria 3073
67 Ga0207674_10000222 3300026116 Bacteria 70839
68 Ga0268266_10011381 3300028379 Bacteria 7737
69 Ga0268266_10331285 3300028379 Bacteria 1427
70 Ga0268264_10016744 3300028381 Bacteria 5999
71 Ga0307410_10048272 3300031852 Bacteria 2850
72 Ga0307409_100002601 3300031995 Bacteria 9494
73 Ga0307409_100015603 3300031995 Bacteria 4992
74 Ga0307409_100178805 3300031995 Bacteria 1876
75 Ga0307411_10073879 3300032005 Bacteria 2321
76 Ga0373947_0136505 3300035725 Unclassified 1570
77 Ga0373937_0006109 3300036401 Bacteria 10366
78 Ga0373937_0145814 3300036401 Bacteria 2216
79 Ga0373937_0170729 3300036401 Bacteria 2041
80 Ga0395900_0451352 3300037418 Bacteria 1242
81 Ga0395898_0608192 3300037466 Bacteria 1036
82 Ga0395905_0178120 3300037471 Bacteria 1996
83 Ga0395901_0057805 3300038443 Bacteria 4034
84 Ga0395901_0068576 3300038443 Bacteria 3695
85 Ga0436365_1059786 3300039437 Bacteria 1511
86 Ga0436360_0992284 3300039438 Bacteria 954
87 Ga0453684_0199038 3300044712 Bacteria 2337
88 Ga0451576_0000092 3300045051 Bacteria 227293
89 Ga0451576_0013947 3300045051 Bacteria 8971
90 Ga0495651_0332097 3300046462 Bacteria 1010
91 Ga0495653_0158204 3300046463 Unclassified 1576
92 Ga0495580_0071837 3300046472 Unclassified 2418
93 Ga0495639_0041519 3300046475 Unclassified 2072
94 Ga0495639_0116096 3300046475 Bacteria 1274
95 Ga0495608_0112951 3300046511 Unclassified 1746
96 Ga0495618_0025348 3300046514 Bacteria 3680
97 Ga0495630_0006693 3300046517 Bacteria 8217
98 Ga0495652_0269273 3300046529 Bacteria 1253
99 Ga0495665_0047887 3300046531 Unclassified 2268
100 Ga0495667_0016956 3300046559 Bacteria 4918
101 Ga0495656_0165019 3300046615 Unclassified 1079
102 Ga0495634_0045391 3300046642 Bacteria 2971
103 Ga0495613_0019922 3300046689 Bacteria 5000
104 Ga0495613_0114472 3300046689 Bacteria 1941
105 Ga0495613_0203278 3300046689 Unclassified 1396
106 Ga0495624_0005862 3300046690 Bacteria 8785
107 Ga0495581_0007668 3300047315 Bacteria 6243
108 Ga0495674_0002650 3300047319 Bacteria 17411
109 Ga0495674_0083932 3300047319 Bacteria 2730
110 Ga0495675_0094825 3300047444 Bacteria 1871
111 Ga0495684_0002540 3300047471 Bacteria 14536
112 Ga0495684_0030861 3300047471 Bacteria 4114
113 Ga0495684_0278058 3300047471 Bacteria 1209
114 Ga0495686_0015797 3300047472 Bacteria 5138
115 Ga0501034_0002125 3300049571 Bacteria 24628
116 Ga0501034_0018173 3300049571 Bacteria 7213
117 Ga0501034_0061273 3300049571 Bacteria 3778
118 Ga0501034_0064878 3300049571 Bacteria 3665
119 Ga0501036_0251339 3300049572 Bacteria 1482
120 Ga0501037_0057004 3300049573 Bacteria 2853
121 Ga0501070_0165236 3300049586 Bacteria 1824
122 Ga0501080_0047111 3300049742 Bacteria 4013
123 Ga0501080_0073011 3300049742 Bacteria 3192
124 Ga0501080_0573008 3300049742 Bacteria 1004
125 Ga0501083_0013628 3300049744 Bacteria 5683
126 Ga0501044_0000209 3300049823 Bacteria 74537
127 Ga0501044_0028096 3300049823 Bacteria 5937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0451352 Ga0395900_0451352_545_1213 222
2 3300046463 Ga0495653_0158204 Ga0495653_0158204_499_1326 227
3 3300049823 Ga0501044_0028096 Ga0501044_0028096_461_1171 234
4 3300025937 Ga0207669_10451852 Ga0207669_104518521 235
5 3300045051 Ga0451576_0013947 Ga0451576_0013947_3835_4629 237
6 3300044712 Ga0453684_0199038 Ga0453684_0199038_1492_2229 243
7 3300005355 Ga0070671_100304883 Ga0070671_1003048832 248
8 3300005366 Ga0070659_100026126 Ga0070659_1000261263 248
9 3300009545 Ga0105237_10415872 Ga0105237_104158722 248
10 3300013105 Ga0157369_10288313 Ga0157369_102883131 248
11 3300025909 Ga0207705_10002669 Ga0207705_100026693 248
12 3300047472 Ga0495686_0015797 Ga0495686_0015797_4288_5037 248
13 3300005539 Ga0068853_100021247 Ga0068853_1000212472 250
14 3300026041 Ga0207639_10053791 Ga0207639_100537912 250
15 iso_pu_bacteria 2920107658 2920109033 251
16 3300037471 Ga0395905_0178120 Ga0395905_0178120_651_1478 254
17 3300038443 Ga0395901_0068576 Ga0395901_0068576_1527_2354 254
18 3300005437 Ga0070710_10059649 Ga0070710_100596492 255
19 3300014325 Ga0163163_11204376 Ga0163163_112043761 255
20 3300046529 Ga0495652_0269273 Ga0495652_0269273_292_1071 255
21 iso_pu_bacteria 2687453341 2688394597 255
22 3300005467 Ga0070706_100205151 Ga0070706_1002051512 256
23 3300005548 Ga0070665_100000930 Ga0070665_10000093030 256
24 3300005843 Ga0068860_100663328 Ga0068860_1006633282 256
25 3300006844 Ga0075428_100035801 Ga0075428_1000358014 256
26 3300006880 Ga0075429_100544453 Ga0075429_1005444532 256
27 3300025910 Ga0207684_10250529 Ga0207684_102505292 256
28 3300028379 Ga0268266_10011381 Ga0268266_100113815 256
29 3300039438 Ga0436360_0992284 Ga0436360_0992284_47_823 256
30 3300049571 Ga0501034_0061273 Ga0501034_0061273_717_1499 256
31 3300049572 Ga0501036_0251339 Ga0501036_0251339_379_1161 256
32 3300005466 Ga0070685_10148972 Ga0070685_101489722 257
33 3300005843 Ga0068860_100264549 Ga0068860_1002645492 257
34 3300028381 Ga0268264_10016744 Ga0268264_100167442 257
35 3300049571 Ga0501034_0064878 Ga0501034_0064878_2566_3363 258
36 3300036401 Ga0373937_0145814 Ga0373937_0145814_365_1159 260
37 3300013307 Ga0157372_11183982 Ga0157372_111839821 265
38 3300049571 Ga0501034_0018173 Ga0501034_0018173_117_914 265
39 3300049573 Ga0501037_0057004 Ga0501037_0057004_365_1162 265
40 3300049586 Ga0501070_0165236 Ga0501070_0165236_801_1598 265
41 3300049742 Ga0501080_0047111 Ga0501080_0047111_1592_2389 265
42 3300049742 Ga0501080_0573008 Ga0501080_0573008_171_968 265
43 3300049823 Ga0501044_0000209 Ga0501044_0000209_17063_17860 265
44 3300005338 Ga0068868_100281266 Ga0068868_1002812662 266
45 3300005347 Ga0070668_100083001 Ga0070668_1000830012 266
46 3300005367 Ga0070667_100078349 Ga0070667_1000783492 266
47 3300005435 Ga0070714_100151360 Ga0070714_1001513601 266
48 3300005436 Ga0070713_100393426 Ga0070713_1003934262 266
49 3300005548 Ga0070665_100288946 Ga0070665_1002889461 266
50 3300005563 Ga0068855_100112171 Ga0068855_1001121713 266
51 3300005563 Ga0068855_100121289 Ga0068855_1001212892 266
52 3300005577 Ga0068857_100027229 Ga0068857_1000272295 266
53 3300005616 Ga0068852_100283461 Ga0068852_1002834611 266
54 3300005843 Ga0068860_100173175 Ga0068860_1001731752 266
55 3300006358 Ga0068871_100702559 Ga0068871_1007025591 266
56 3300006358 Ga0068871_100793638 Ga0068871_1007936381 266
57 3300009174 Ga0105241_10071348 Ga0105241_100713483 266
58 3300009177 Ga0105248_10496804 Ga0105248_104968042 266
59 3300009545 Ga0105237_10173449 Ga0105237_101734492 266
60 3300010375 Ga0105239_10017429 Ga0105239_100174297 266
61 3300013100 Ga0157373_10065646 Ga0157373_100656462 266
62 3300013102 Ga0157371_10064613 Ga0157371_100646132 266
63 3300013102 Ga0157371_10087039 Ga0157371_100870393 266
64 3300013102 Ga0157371_10152319 Ga0157371_101523192 266
65 3300013105 Ga0157369_10071227 Ga0157369_100712271 266
66 3300013307 Ga0157372_10032858 Ga0157372_100328582 266
67 3300013307 Ga0157372_10094328 Ga0157372_100943282 266
68 3300013307 Ga0157372_10152081 Ga0157372_101520813 266
69 3300025928 Ga0207700_10344757 Ga0207700_103447572 266
70 3300025941 Ga0207711_10254320 Ga0207711_102543202 266
71 3300025949 Ga0207667_10190995 Ga0207667_101909952 266
72 3300025986 Ga0207658_10057197 Ga0207658_100571973 266
73 3300026116 Ga0207674_10000222 Ga0207674_1000022270 266
74 3300028379 Ga0268266_10331285 Ga0268266_103312851 266
75 3300035725 Ga0373947_0136505 Ga0373947_0136505_276_1076 266
76 3300036401 Ga0373937_0006109 Ga0373937_0006109_939_1742 266
77 3300036401 Ga0373937_0170729 Ga0373937_0170729_155_964 266
78 3300037466 Ga0395898_0608192 Ga0395898_0608192_149_949 266
79 3300038443 Ga0395901_0057805 Ga0395901_0057805_3084_3884 266
80 3300045051 Ga0451576_0000092 Ga0451576_0000092_44937_45755 266
81 3300046462 Ga0495651_0332097 Ga0495651_0332097_57_860 266
82 3300046472 Ga0495580_0071837 Ga0495580_0071837_194_994 266
83 3300046475 Ga0495639_0041519 Ga0495639_0041519_56_856 266
84 3300046475 Ga0495639_0116096 Ga0495639_0116096_434_1237 266
85 3300046511 Ga0495608_0112951 Ga0495608_0112951_639_1439 266
86 3300046514 Ga0495618_0025348 Ga0495618_0025348_2744_3547 266
87 3300046517 Ga0495630_0006693 Ga0495630_0006693_315_1115 266
88 3300046531 Ga0495665_0047887 Ga0495665_0047887_393_1193 266
89 3300046559 Ga0495667_0016956 Ga0495667_0016956_3617_4420 266
90 3300046615 Ga0495656_0165019 Ga0495656_0165019_118_918 266
91 3300046642 Ga0495634_0045391 Ga0495634_0045391_755_1558 266
92 3300046689 Ga0495613_0019922 Ga0495613_0019922_147_950 266
93 3300046689 Ga0495613_0114472 Ga0495613_0114472_37_840 266
94 3300046689 Ga0495613_0203278 Ga0495613_0203278_101_901 266
95 3300046690 Ga0495624_0005862 Ga0495624_0005862_6309_7109 266
96 3300047315 Ga0495581_0007668 Ga0495581_0007668_1363_2163 266
97 3300047319 Ga0495674_0002650 Ga0495674_0002650_15745_16545 266
98 3300047319 Ga0495674_0083932 Ga0495674_0083932_385_1188 266
99 3300047444 Ga0495675_0094825 Ga0495675_0094825_140_943 266
100 3300047471 Ga0495684_0002540 Ga0495684_0002540_13141_13941 266
101 3300047471 Ga0495684_0030861 Ga0495684_0030861_336_1139 266
102 3300047471 Ga0495684_0278058 Ga0495684_0278058_106_915 266
103 3300049742 Ga0501080_0073011 Ga0501080_0073011_1907_2713 266
104 3300049744 Ga0501083_0013628 Ga0501083_0013628_4468_5274 266
105 3300005335 Ga0070666_10246033 Ga0070666_102460331 267
106 3300005354 Ga0070675_100014362 Ga0070675_1000143626 267
107 3300005355 Ga0070671_100418280 Ga0070671_1004182801 267
108 3300005436 Ga0070713_100233899 Ga0070713_1002338991 267
109 3300005564 Ga0070664_100091547 Ga0070664_1000915472 267
110 3300009177 Ga0105248_10157006 Ga0105248_101570063 267
111 3300013306 Ga0163162_10719367 Ga0163162_107193671 267
112 3300025903 Ga0207680_10206589 Ga0207680_102065891 267
113 3300025925 Ga0207650_10069640 Ga0207650_100696402 267
114 3300025931 Ga0207644_10039669 Ga0207644_100396693 267
115 3300031852 Ga0307410_10048272 Ga0307410_100482723 267
116 3300031995 Ga0307409_100002601 Ga0307409_1000026019 267
117 3300031995 Ga0307409_100015603 Ga0307409_1000156033 267
118 3300032005 Ga0307411_10073879 Ga0307411_100738792 267
119 3300039437 Ga0436365_1059786 Ga0436365_1059786_149_976 267
120 3300049571 Ga0501034_0002125 Ga0501034_0002125_15613_16470 267
121 3300005331 Ga0070670_100100980 Ga0070670_1001009803 268
122 3300005347 Ga0070668_100470878 Ga0070668_1004708782 268
123 3300005353 Ga0070669_100211143 Ga0070669_1002111431 268
124 3300005354 Ga0070675_100018123 Ga0070675_1000181232 268
125 3300005457 Ga0070662_100089169 Ga0070662_1000891691 268
126 3300005543 Ga0070672_100083950 Ga0070672_1000839502 268
127 3300025926 Ga0207659_10174672 Ga0207659_101746721 268
128 3300025940 Ga0207691_10069550 Ga0207691_100695503 268
129 3300031995 Ga0307409_100178805 Ga0307409_1001788052 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

2

172

0.95

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

177

293

0.9

PF01965

DJ-1_PfpI

DJ-1/PfpI family

4

113

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jta-assembly1.cif.gz_A crystal structure of d464a l465a mutant of fgam synthetase 0.9106 2 259
1t3t-assembly1.cif.gz_A structure of formylglycinamide synthetase 0.9068 2 259
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.9027 3 259
6lyk-assembly1.cif.gz_A crystal structure of r1263a mutant of formylglycinamidine synthetase 0.8968 3 259
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8962 2 258
ID Description Score Start End Superfamily
af_Q19311_995_1323_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.92 2 259 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9171 5 261 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9152 1 260 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9117 5 260 3.40.50.880
af_P35421_1030_1350_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9083 2 260 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2E1MVW1-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9629 5 259 GO:0004642
GO:0005737
GO:0006189
GO:0006541
AF-A0A257LV28-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9624 4 262 GO:0004642
GO:0005737
GO:0006189
GO:0006541
AF-A0A2M7SBE2-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9604 1 262 GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
AF-A0A7C5IG59-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.9595 1 221 GO:0004642
GO:0005737
GO:0006189
AF-A0A7C2QF95-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9592 2 262 GO:0004642
GO:0005737
GO:0006189
GO:0006541

Feature Viewer

pLDDT pTM Quality
89.8 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map