F141723

General Info

Members Datasets Scaffolds Average Seq Length
129 95 258 111

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10098736|Ga0105239_100987362
Length 124
Sequence VSALSVRAAILAAMAYDEELAERLRAVLAREKGLTEKRMFGGLAFLLGGHMAVAASGKGGLLLRCDPAETESLVAEAGAGPFVMRGKEMDGWLYVATDAVEDDAALQRWVSHGVDYVRGLPPKG

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
61 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
62 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
92 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
95 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.38
Nodule 0
Rhizoplane 7.75
Rhizosphere 69.77
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10098736 3300010375 Bacteria 3228
2 Ga0070658_10003029 3300005327 Bacteria 13908
3 Ga0070713_100446502 3300005436 Bacteria 1214
4 Ga0070685_10071322 3300005466 Bacteria 2059
5 Ga0070685_10838088 3300005466 Unclassified 680
6 Ga0070684_100357824 3300005535 Bacteria 1343
7 Ga0070684_100573530 3300005535 Bacteria 1048
8 Ga0068855_100033631 3300005563 Bacteria 6117
9 Ga0068855_100145440 3300005563 Bacteria 2699
10 Ga0068856_100356735 3300005614 Bacteria 1481
11 Ga0068852_100013863 3300005616 Bacteria 6182
12 Ga0068852_100785092 3300005616 Bacteria 966
13 Ga0068864_101559462 3300005618 Bacteria 664
14 Ga0068870_10119532 3300005840 Bacteria 1516
15 Ga0068860_100000902 3300005843 Bacteria 32958
16 Ga0068860_101709187 3300005843 Bacteria 651
17 Ga0070717_10288375 3300006028 Bacteria 1457
18 Ga0070717_11155455 3300006028 Bacteria 705
19 Ga0075365_10098846 3300006038 Bacteria 1997
20 Ga0075365_10212127 3300006038 Bacteria 1357
21 Ga0075365_10312203 3300006038 Bacteria 1107
22 Ga0075365_11213952 3300006038 Bacteria 530
23 Ga0075368_10000612 3300006042 Bacteria 10786
24 Ga0075363_100001542 3300006048 Bacteria 8829
25 Ga0075363_100133167 3300006048 Bacteria 1395
26 Ga0075363_100423065 3300006048 Bacteria 784
27 Ga0075364_10088799 3300006051 Bacteria 2050
28 Ga0075364_10112188 3300006051 Bacteria 1820
29 Ga0075364_10731917 3300006051 Bacteria 675
30 Ga0075367_10024760 3300006178 Bacteria 3386
31 Ga0075367_11053993 3300006178 Bacteria 520
32 Ga0075370_10003995 3300006353 Bacteria 7086
33 Ga0075370_10195232 3300006353 Bacteria 1193
34 Ga0075435_101145233 3300007076 Bacteria 680
35 Ga0105240_10050677 3300009093 Bacteria 5232
36 Ga0105240_11290125 3300009093 Bacteria 770
37 Ga0105243_10884893 3300009148 Bacteria 887
38 Ga0105241_10257296 3300009174 Bacteria 1482
39 Ga0105241_12417957 3300009174 Unclassified 525
40 Ga0105237_10071442 3300009545 Bacteria 3465
41 Ga0105238_10661774 3300009551 Bacteria 1055
42 Ga0105238_10904224 3300009551 Bacteria 901
43 Ga0105239_10550427 3300010375 Unclassified 1314
44 Ga0105246_10845016 3300011119 Bacteria 816
45 Ga0157370_10304706 3300013104 Unclassified 1470
46 Ga0157369_10571433 3300013105 Bacteria 1168
47 Ga0157372_11449585 3300013307 Bacteria 791
48 Ga0157375_10329105 3300013308 Bacteria 1693
49 Ga0157375_10675183 3300013308 Bacteria 1188
50 Ga0163163_11453455 3300014325 Bacteria 747
51 Ga0157380_11261884 3300014326 Bacteria 785
52 Ga0157379_11374195 3300014968 Bacteria 684
53 Ga0157376_12556915 3300014969 Bacteria 550
54 Ga0207642_11076356 3300025899 Bacteria 519
55 Ga0207647_10110349 3300025904 Bacteria 1627
56 Ga0207643_10175941 3300025908 Bacteria 1293
57 Ga0207643_10551060 3300025908 Bacteria 740
58 Ga0207705_10093562 3300025909 Bacteria 2204
59 Ga0207654_10075675 3300025911 Bacteria 2012
60 Ga0207654_10174192 3300025911 Bacteria 1399
61 Ga0207654_11025875 3300025911 Bacteria 600
62 Ga0207671_10041366 3300025914 Bacteria 3411
63 Ga0207694_11591774 3300025924 Bacteria 551
64 Ga0207664_10032990 3300025929 Bacteria 3974
65 Ga0207644_10575467 3300025931 Bacteria 934
66 Ga0207690_10431684 3300025932 Bacteria 1056
67 Ga0207667_10097591 3300025949 Bacteria 3033
68 Ga0207667_10328540 3300025949 Bacteria 1561
69 Ga0207678_11133451 3300026067 Bacteria 693
70 Ga0207708_10740588 3300026075 Bacteria 843
71 Ga0207702_10442803 3300026078 Bacteria 1259
72 Ga0207676_11030451 3300026095 Bacteria 812
73 Ga0207674_11594344 3300026116 Bacteria 621
74 Ga0207698_10009461 3300026142 Bacteria 6216
75 Ga0207698_10696364 3300026142 Bacteria 1011
76 Ga0209813_10006019 3300027866 Bacteria 2977
77 Ga0268264_10000664 3300028381 Bacteria 40313
78 Ga0265334_10078217 3300028573 Bacteria 1222
79 Ga0265327_10100207 3300031251 Bacteria 1399
80 Ga0307413_11344029 3300031824 Bacteria 627
81 Ga0307410_11430407 3300031852 Bacteria 608
82 Ga0307415_100228137 3300032126 Bacteria 1498
83 Ga0395901_0094895 3300038443 Bacteria 3126
84 Ga0436365_1046649 3300039437 Bacteria 1080
85 Ga0451802_0161844 3300041460 Bacteria 500
86 Ga0451807_2205578 3300041486 Unclassified 546
87 Ga0451841_1213120 3300041498 Bacteria 563
88 Ga0451843_1205579 3300041509 Bacteria 534
89 Ga0451853_3247197 3300041512 Bacteria 631
90 Ga0466972_0091730 3300044658 Bacteria 1440
91 Ga0466972_0402689 3300044658 Bacteria 641
92 Ga0466965_0039038 3300044683 Bacteria 2333
93 Ga0466963_0268282 3300044694 Bacteria 1199
94 Ga0466964_0449997 3300044706 Bacteria 683
95 Ga0466968_0495875 3300044735 Bacteria 608
96 Ga0466970_0028994 3300044765 Bacteria 2912
97 Ga0466970_0107104 3300044765 Bacteria 1525
98 Ga0466970_0369339 3300044765 Unclassified 816
99 Ga0466960_0008790 3300044901 Bacteria 4147
100 Ga0466960_0291879 3300044901 Bacteria 917
101 Ga0466959_0401141 3300045049 Bacteria 932
102 Ga0466958_0529888 3300045836 Bacteria 765
103 Ga0466967_0092803 3300045976 Unclassified 2746
104 Ga0495588_0117345 3300046674 Bacteria 1403
105 Ga0495672_0274948 3300047320 Bacteria 807
106 Ga0496102_0191615 3300048905 Bacteria 1927
107 Ga0496106_0270939 3300048909 Bacteria 1359
108 Ga0496108_0316177 3300048911 Bacteria 1361
109 Ga0496108_0573424 3300048911 Bacteria 984
110 Ga0496109_1151000 3300048912 Unclassified 713
111 Ga0496111_1309671 3300048914 Bacteria 510
112 Ga0496114_0031757 3300048917 Bacteria 4345
113 Ga0496115_0639126 3300048918 Bacteria 842
114 Ga0501034_0156454 3300049571 Bacteria 2253
115 Ga0501070_0355076 3300049586 Bacteria 1189
116 Ga0501072_0138115 3300049588 Bacteria 1943
117 Ga0501080_0980908 3300049742 Bacteria 734
118 nmdc:mga03n38_12994_c1 3300050490 Bacteria 3150
119 nmdc:mga03n38_295243_c1 3300050490 Bacteria 869
120 nmdc:mga03n38_831922_c1 3300050490 Bacteria 539
121 nmdc:mga0yw44_211947_c1 3300050492 Bacteria 1282
122 nmdc:mga06z11_7890_c1 3300050494 Bacteria 4408
123 nmdc:mga04h51_345415_c1 3300050495 Bacteria 614
124 nmdc:mga04h51_619_c1 3300050495 Bacteria 8362
125 nmdc:mga07m45_495176_c1 3300050496 Bacteria 708
126 nmdc:mga07m45_8322_c1 3300050496 Bacteria 5327
127 nmdc:mga05p37_860747_c1 3300050507 Bacteria 983
128 Ga0466962_0089138 3300061719 Bacteria 1477
129 8054477798 8054472261 Bacteria 7464355
130 Ga0105239_10098736
131 Ga0070658_10003029
132 Ga0070713_100446502
133 Ga0070685_10071322
134 Ga0070685_10838088
135 Ga0070684_100357824
136 Ga0070684_100573530
137 Ga0068855_100033631
138 Ga0068855_100145440
139 Ga0068856_100356735
140 Ga0068852_100013863
141 Ga0068852_100785092
142 Ga0068864_101559462
143 Ga0068870_10119532
144 Ga0068860_100000902
145 Ga0068860_101709187
146 Ga0070717_10288375
147 Ga0070717_11155455
148 Ga0075365_10098846
149 Ga0075365_10212127
150 Ga0075365_10312203
151 Ga0075365_11213952
152 Ga0075368_10000612
153 Ga0075363_100001542
154 Ga0075363_100133167
155 Ga0075363_100423065
156 Ga0075364_10088799
157 Ga0075364_10112188
158 Ga0075364_10731917
159 Ga0075367_10024760
160 Ga0075367_11053993
161 Ga0075370_10003995
162 Ga0075370_10195232
163 Ga0075435_101145233
164 Ga0105240_10050677
165 Ga0105240_11290125
166 Ga0105243_10884893
167 Ga0105241_10257296
168 Ga0105241_12417957
169 Ga0105237_10071442
170 Ga0105238_10661774
171 Ga0105238_10904224
172 Ga0105239_10550427
173 Ga0105246_10845016
174 Ga0157370_10304706
175 Ga0157369_10571433
176 Ga0157372_11449585
177 Ga0157375_10329105
178 Ga0157375_10675183
179 Ga0163163_11453455
180 Ga0157380_11261884
181 Ga0157379_11374195
182 Ga0157376_12556915
183 Ga0207642_11076356
184 Ga0207647_10110349
185 Ga0207643_10175941
186 Ga0207643_10551060
187 Ga0207705_10093562
188 Ga0207654_10075675
189 Ga0207654_10174192
190 Ga0207654_11025875
191 Ga0207671_10041366
192 Ga0207694_11591774
193 Ga0207664_10032990
194 Ga0207644_10575467
195 Ga0207690_10431684
196 Ga0207667_10097591
197 Ga0207667_10328540
198 Ga0207678_11133451
199 Ga0207708_10740588
200 Ga0207702_10442803
201 Ga0207676_11030451
202 Ga0207674_11594344
203 Ga0207698_10009461
204 Ga0207698_10696364
205 Ga0209813_10006019
206 Ga0268264_10000664
207 Ga0265334_10078217
208 Ga0265327_10100207
209 Ga0307413_11344029
210 Ga0307410_11430407
211 Ga0307415_100228137
212 Ga0395901_0094895
213 Ga0436365_1046649
214 Ga0451802_0161844
215 Ga0451807_2205578
216 Ga0451841_1213120
217 Ga0451843_1205579
218 Ga0451853_3247197
219 Ga0466972_0091730
220 Ga0466972_0402689
221 Ga0466965_0039038
222 Ga0466963_0268282
223 Ga0466964_0449997
224 Ga0466968_0495875
225 Ga0466970_0028994
226 Ga0466970_0107104
227 Ga0466970_0369339
228 Ga0466960_0008790
229 Ga0466960_0291879
230 Ga0466959_0401141
231 Ga0466958_0529888
232 Ga0466967_0092803
233 Ga0495588_0117345
234 Ga0495672_0274948
235 Ga0496102_0191615
236 Ga0496106_0270939
237 Ga0496108_0316177
238 Ga0496108_0573424
239 Ga0496109_1151000
240 Ga0496111_1309671
241 Ga0496114_0031757
242 Ga0496115_0639126
243 Ga0501034_0156454
244 Ga0501070_0355076
245 Ga0501072_0138115
246 Ga0501080_0980908
247 nmdc:mga03n38_12994_c1
248 nmdc:mga03n38_295243_c1
249 nmdc:mga03n38_831922_c1
250 nmdc:mga0yw44_211947_c1
251 nmdc:mga06z11_7890_c1
252 nmdc:mga04h51_345415_c1
253 nmdc:mga04h51_619_c1
254 nmdc:mga07m45_495176_c1
255 nmdc:mga07m45_8322_c1
256 nmdc:mga05p37_860747_c1
257 Ga0466962_0089138
258 8054477798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

26

116

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.8407 48 104
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7118 8 109
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6748 7 109
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.668 8 109
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6586 9 99
ID Description Score Start End Superfamily
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7644 9 109 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7319 5 107 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7118 8 109 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7103 9 109 3.90.1150.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.6952 9 103 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9667 2 109
AF-A0A2S8LQ61-F1-model_v4 deleted 0.9666 1 84
AF-A0A413RIH2-F1-model_v4 TfoX family protein 0.9649 3 107
AF-A0A1C4XWA8-F1-model_v4 TfoX N-terminal domain-containing protein 0.9648 1 105
AF-A0A1H1ZJY3-F1-model_v4 TfoX N-terminal domain-containing protein 0.9641 1 109

Map