F140604

General Info

Members Datasets Scaffolds Average Seq Length
129 67 129 144

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100270640|Ga0070680_1002706403
Length 158
Sequence MYINKVMLFGNLTRDPEMRAMPSGGNVTSFSVATNRVYKKADGTRAEQTDYHNVVVFGRQAETSAQYLKKGSSVYIEGRLQTRSWDKEGVKQYRTEVIADRVQFGPRPAGAGSAPAAHEDFGNASDAEAPLAGQAQKSHKEDAIDYPAEDINPDDIPF

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
27 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
30 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
31 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
34 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
35 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
38 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
39 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
40 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
46 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
47 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
57 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
58 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
59 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
60 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
61 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
62 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
64 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
65 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
66 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
67 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 0
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10094905 3300003320 Bacteria 1746
2 Ga0070680_100122857 3300005336 Unclassified 2168
3 Ga0070680_100270640 3300005336 Bacteria 1438
4 Ga0070680_100481879 3300005336 Bacteria 1060
5 Ga0070671_100015262 3300005355 Bacteria 6203
6 Ga0070701_10012540 3300005438 Bacteria 3826
7 Ga0070711_100280927 3300005439 Bacteria 1317
8 Ga0070681_10001701 3300005458 Bacteria 19683
9 Ga0070681_10570280 3300005458 Bacteria 1046
10 Ga0070706_100384278 3300005467 Bacteria 1307
11 Ga0070679_100015115 3300005530 Bacteria 7419
12 Ga0070679_100719194 3300005530 Unclassified 941
13 Ga0070679_100972331 3300005530 Bacteria 793
14 Ga0070684_102015266 3300005535 Unclassified 545
15 Ga0070686_100110429 3300005544 Unclassified 1872
16 Ga0070696_100396052 3300005546 Bacteria 1079
17 Ga0070704_100000004 3300005549 Bacteria 124064
18 Ga0070704_100339506 3300005549 Bacteria 1264
19 Ga0070704_101242945 3300005549 Unclassified 680
20 Ga0068855_100011102 3300005563 Bacteria 10872
21 Ga0068855_100405125 3300005563 Unclassified 1494
22 Ga0068855_100573341 3300005563 Bacteria 1220
23 Ga0068857_100664740 3300005577 Bacteria 988
24 Ga0068856_100019341 3300005614 Bacteria 6612
25 Ga0070717_10047297 3300006028 Bacteria 3524
26 Ga0105238_11217358 3300009551 Bacteria 778
27 Ga0105238_13010426 3300009551 Bacteria 506
28 Ga0157370_12087985 3300013104 Bacteria 508
29 Ga0207707_10000098 3300025912 Bacteria 87035
30 Ga0207660_10369345 3300025917 Bacteria 1152
31 Ga0207652_10007996 3300025921 Bacteria 8487
32 Ga0207652_10009766 3300025921 Bacteria 7723
33 Ga0207652_10020763 3300025921 Bacteria 5413
34 Ga0207652_10252046 3300025921 Bacteria 1592
35 Ga0207644_10001477 3300025931 Bacteria 15122
36 Ga0207644_11738671 3300025931 Unclassified 522
37 Ga0207667_10333716 3300025949 Unclassified 1548
38 Ga0207667_11230248 3300025949 Bacteria 727
39 Ga0207702_10166924 3300026078 Bacteria 2015
40 Ga0265319_1040881 3300028563 Unclassified 1566
41 Ga0265322_10113851 3300028654 Bacteria 770
42 Ga0265336_10000015 3300028666 Bacteria 239654
43 Ga0265336_10005703 3300028666 Bacteria 4564
44 Ga0265338_10000002 3300028800 Bacteria 856588
45 Ga0265338_10000659 3300028800 Bacteria 59769
46 Ga0265338_10001297 3300028800 Bacteria 40934
47 Ga0265338_10012814 3300028800 Bacteria 9531
48 Ga0265338_10015863 3300028800 Bacteria 8246
49 Ga0265338_10121390 3300028800 Bacteria 2082
50 Ga0265338_10376771 3300028800 Bacteria 1016
51 Ga0265338_10458512 3300028800 Bacteria 902
52 Ga0265324_10014394 3300029957 Bacteria 2927
53 Ga0265332_10203640 3300031238 Unclassified 822
54 Ga0265320_10208979 3300031240 Bacteria 871
55 Ga0265340_10000027 3300031247 Bacteria 70367
56 Ga0265327_10011318 3300031251 Bacteria 6163
57 Ga0265316_10000060 3300031344 Bacteria 114635
58 Ga0265316_10004840 3300031344 Bacteria 13273
59 Ga0265316_10014486 3300031344 Bacteria 6935
60 Ga0265313_10004694 3300031595 Bacteria 10316
61 Ga0265314_10050918 3300031711 Bacteria 2887
62 Ga0265314_10132466 3300031711 Unclassified 1553
63 Ga0265314_10173668 3300031711 Bacteria 1298
64 Ga0265342_10001430 3300031712 Bacteria 22256
65 Ga0265342_10397808 3300031712 Bacteria 712
66 Ga0373927_0286341 3300035695 Unclassified 1084
67 Ga0373925_0062044 3300037068 Unclassified 2810
68 Ga0451849_0607343 3300041505 Bacteria 3058
69 Ga0451577_0000056 3300042876 Bacteria 273200
70 Ga0451577_0162122 3300042876 Bacteria 2014
71 Ga0451577_0270078 3300042876 Bacteria 1540
72 Ga0451577_0487700 3300042876 Bacteria 1119
73 Ga0451577_0848528 3300042876 Bacteria 824
74 Ga0451577_1301736 3300042876 Bacteria 646
75 Ga0453683_0132233 3300044673 Bacteria 1573
76 Ga0453684_0001716 3300044712 Bacteria 58825
77 Ga0453684_0010330 3300044712 Bacteria 15984
78 Ga0453684_0019504 3300044712 Bacteria 10317
79 Ga0451576_0001904 3300045051 Bacteria 33468
80 Ga0451576_0008061 3300045051 Bacteria 12426
81 Ga0451576_0140951 3300045051 Bacteria 2514
82 Ga0451576_0228942 3300045051 Bacteria 1941
83 Ga0451576_0385682 3300045051 Bacteria 1469
84 Ga0451576_0691563 3300045051 Bacteria 1072
85 Ga0451576_1037593 3300045051 Bacteria 859
86 Ga0451576_2232626 3300045051 Unclassified 562
87 Ga0496121_0368509 3300048924 Viruses 951
88 Ga0501299_074106 3300049522 Bacteria 744
89 Ga0501032_0091582 3300049569 Unclassified 2017
90 Ga0501034_0000905 3300049571 Bacteria 43220
91 Ga0501034_0000934 3300049571 Bacteria 42540
92 Ga0501034_0004469 3300049571 Bacteria 15549
93 Ga0501034_0021911 3300049571 Bacteria 6511
94 Ga0501034_0073846 3300049571 Bacteria 3419
95 Ga0501034_0114265 3300049571 Bacteria 2688
96 Ga0501034_0138543 3300049571 Unclassified 2414
97 Ga0501034_0550245 3300049571 Unclassified 1063
98 Ga0501034_0619732 3300049571 Bacteria 986
99 Ga0501036_0670103 3300049572 Bacteria 858
100 Ga0501037_0037755 3300049573 Bacteria 3561
101 Ga0501038_0086062 3300049574 Bacteria 2642
102 Ga0501039_0114583 3300049575 Unclassified 2109
103 Ga0501039_0357390 3300049575 Bacteria 1148
104 Ga0501043_0043643 3300049579 Unclassified 3524
105 Ga0501043_0704265 3300049579 Bacteria 737
106 Ga0501046_0115319 3300049580 Bacteria 2049
107 Ga0501047_0012044 3300049581 Bacteria 8184
108 Ga0501047_0014069 3300049581 Bacteria 7603
109 Ga0501047_0237328 3300049581 Bacteria 1675
110 Ga0501047_0275556 3300049581 Unclassified 1528
111 Ga0501067_0004970 3300049583 Bacteria 7388
112 Ga0501073_0000001 3300049589 Bacteria 677932
113 Ga0501073_0004142 3300049589 Bacteria 10876
114 Ga0501074_0049297 3300049590 Unclassified 3040
115 Ga0501074_0225672 3300049590 Bacteria 1333
116 Ga0501249_000495 3300049679 Bacteria 9710
117 Ga0501080_0000393 3300049742 Bacteria 33669
118 Ga0501080_0061254 3300049742 Unclassified 3504
119 Ga0501080_1267033 3300049742 Unclassified 632
120 Ga0501080_1574582 3300049742 Bacteria 557
121 Ga0501083_0019089 3300049744 Bacteria 4774
122 Ga0501083_0052645 3300049744 Bacteria 2735
123 Ga0501035_0069942 3300049822 Bacteria 3110
124 Ga0501044_0857447 3300049823 Bacteria 785
125 Ga0500556_0001234 3300053104 Bacteria 11879
126 Ga0500616_0000174 3300053153 Bacteria 107571
127 Ga0501084_0077063 3300054114 Bacteria 2795
128 Ga0501082_0000003 3300060353 Bacteria 170684
129 Ga0501082_0000387 3300060353 Bacteria 39051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0061254 Ga0501080_0061254_941_1381 122
2 3300049571 Ga0501034_0550245 Ga0501034_0550245_575_1000 125
3 3300028800 Ga0265338_10000002 Ga0265338_1000000235 126
4 3300029957 Ga0265324_10014394 Ga0265324_100143942 126
5 3300045051 Ga0451576_0228942 Ga0451576_0228942_1506_1931 126
6 3300049744 Ga0501083_0019089 Ga0501083_0019089_3118_3576 126
7 3300005577 Ga0068857_100664740 Ga0068857_1006647402 128
8 3300005438 Ga0070701_10012540 Ga0070701_100125406 129
9 3300005549 Ga0070704_100000004 Ga0070704_100000004103 129
10 3300028666 Ga0265336_10000015 Ga0265336_1000001597 129
11 3300028800 Ga0265338_10001297 Ga0265338_100012976 129
12 3300049571 Ga0501034_0114265 Ga0501034_0114265_715_1158 129
13 3300053104 Ga0500556_0001234 Ga0500556_0001234_5581_6072 129
14 3300028800 Ga0265338_10121390 Ga0265338_101213904 130
15 3300028800 Ga0265338_10458512 Ga0265338_104585122 130
16 3300005546 Ga0070696_100396052 Ga0070696_1003960522 131
17 3300009551 Ga0105238_13010426 Ga0105238_130104261 131
18 3300045051 Ga0451576_0008061 Ga0451576_0008061_1589_2053 131
19 3300045051 Ga0451576_2232626 Ga0451576_2232626_91_546 131
20 3300048924 Ga0496121_0368509 Ga0496121_0368509_333_749 131
21 3300049573 Ga0501037_0037755 Ga0501037_0037755_2001_2447 131
22 3300049575 Ga0501039_0357390 Ga0501039_0357390_113_559 131
23 3300049581 Ga0501047_0275556 Ga0501047_0275556_246_710 131
24 3300049742 Ga0501080_1267033 Ga0501080_1267033_138_584 131
25 3300005530 Ga0070679_100719194 Ga0070679_1007191942 132
26 3300009551 Ga0105238_11217358 Ga0105238_112173582 132
27 3300025921 Ga0207652_10020763 Ga0207652_100207639 132
28 3300028563 Ga0265319_1040881 Ga0265319_10408812 132
29 3300028666 Ga0265336_10005703 Ga0265336_100057036 132
30 3300028800 Ga0265338_10015863 Ga0265338_100158636 132
31 3300028800 Ga0265338_10376771 Ga0265338_103767713 132
32 3300031240 Ga0265320_10208979 Ga0265320_102089791 132
33 3300031247 Ga0265340_10000027 Ga0265340_1000002741 132
34 3300031344 Ga0265316_10014486 Ga0265316_100144866 132
35 3300031595 Ga0265313_10004694 Ga0265313_100046944 132
36 3300045051 Ga0451576_0140951 Ga0451576_0140951_797_1243 132
37 3300045051 Ga0451576_0385682 Ga0451576_0385682_504_950 132
38 3300045051 Ga0451576_1037593 Ga0451576_1037593_73_525 132
39 3300049571 Ga0501034_0004469 Ga0501034_0004469_3048_3497 132
40 3300049571 Ga0501034_0073846 Ga0501034_0073846_1773_2228 132
41 3300049571 Ga0501034_0138543 Ga0501034_0138543_960_1412 132
42 3300049579 Ga0501043_0704265 Ga0501043_0704265_238_684 132
43 3300049581 Ga0501047_0014069 Ga0501047_0014069_2139_2594 132
44 3300049581 Ga0501047_0237328 Ga0501047_0237328_596_1045 132
45 3300049589 Ga0501073_0004142 Ga0501073_0004142_4302_4751 132
46 3300049590 Ga0501074_0225672 Ga0501074_0225672_93_545 132
47 3300049742 Ga0501080_1574582 Ga0501080_1574582_91_546 132
48 3300060353 Ga0501082_0000003 Ga0501082_0000003_143282_143734 132
49 3300005336 Ga0070680_100122857 Ga0070680_1001228574 133
50 3300005336 Ga0070680_100270640 Ga0070680_1002706403 133
51 3300005458 Ga0070681_10001701 Ga0070681_1000170115 133
52 3300005458 Ga0070681_10570280 Ga0070681_105702803 133
53 3300005530 Ga0070679_100972331 Ga0070679_1009723311 133
54 3300005549 Ga0070704_100339506 Ga0070704_1003395062 133
55 3300005563 Ga0068855_100011102 Ga0068855_1000111027 133
56 3300005563 Ga0068855_100573341 Ga0068855_1005733411 133
57 3300013104 Ga0157370_12087985 Ga0157370_120879851 133
58 3300025912 Ga0207707_10000098 Ga0207707_1000009869 133
59 3300025921 Ga0207652_10007996 Ga0207652_100079965 133
60 3300025921 Ga0207652_10252046 Ga0207652_102520463 133
61 3300025931 Ga0207644_11738671 Ga0207644_117386711 133
62 3300025949 Ga0207667_11230248 Ga0207667_112302481 133
63 3300028800 Ga0265338_10012814 Ga0265338_100128148 133
64 3300031238 Ga0265332_10203640 Ga0265332_102036402 133
65 3300031711 Ga0265314_10050918 Ga0265314_100509183 133
66 3300035695 Ga0373927_0286341 Ga0373927_0286341_306_779 133
67 3300037068 Ga0373925_0062044 Ga0373925_0062044_919_1395 133
68 3300042876 Ga0451577_0162122 Ga0451577_0162122_299_736 133
69 3300049571 Ga0501034_0000905 Ga0501034_0000905_16960_17394 133
70 3300049679 Ga0501249_000495 Ga0501249_000495_5023_5472 133
71 3300049822 Ga0501035_0069942 Ga0501035_0069942_497_949 133
72 3300049823 Ga0501044_0857447 Ga0501044_0857447_15_494 133
73 3300054114 Ga0501084_0077063 Ga0501084_0077063_2234_2683 133
74 3300003320 rootH2_10094905 rootH2_100949053 134
75 3300005336 Ga0070680_100481879 Ga0070680_1004818792 134
76 3300005355 Ga0070671_100015262 Ga0070671_1000152626 134
77 3300005439 Ga0070711_100280927 Ga0070711_1002809274 134
78 3300005467 Ga0070706_100384278 Ga0070706_1003842783 134
79 3300005530 Ga0070679_100015115 Ga0070679_1000151157 134
80 3300005535 Ga0070684_102015266 Ga0070684_1020152661 134
81 3300005544 Ga0070686_100110429 Ga0070686_1001104292 134
82 3300005549 Ga0070704_101242945 Ga0070704_1012429452 134
83 3300005563 Ga0068855_100405125 Ga0068855_1004051252 134
84 3300005614 Ga0068856_100019341 Ga0068856_1000193417 134
85 3300006028 Ga0070717_10047297 Ga0070717_100472975 134
86 3300025917 Ga0207660_10369345 Ga0207660_103693452 134
87 3300025921 Ga0207652_10009766 Ga0207652_100097668 134
88 3300025931 Ga0207644_10001477 Ga0207644_100014774 134
89 3300025949 Ga0207667_10333716 Ga0207667_103337162 134
90 3300026078 Ga0207702_10166924 Ga0207702_101669242 134
91 3300028654 Ga0265322_10113851 Ga0265322_101138512 134
92 3300028800 Ga0265338_10000659 Ga0265338_1000065918 134
93 3300031251 Ga0265327_10011318 Ga0265327_100113186 134
94 3300031344 Ga0265316_10000060 Ga0265316_1000006082 134
95 3300031344 Ga0265316_10004840 Ga0265316_1000484010 134
96 3300031711 Ga0265314_10132466 Ga0265314_101324662 134
97 3300031711 Ga0265314_10173668 Ga0265314_101736681 134
98 3300031712 Ga0265342_10001430 Ga0265342_100014307 134
99 3300031712 Ga0265342_10397808 Ga0265342_103978082 134
100 3300041505 Ga0451849_0607343 Ga0451849_0607343_1833_2312 134
101 3300042876 Ga0451577_0000056 Ga0451577_0000056_205423_205872 134
102 3300042876 Ga0451577_0270078 Ga0451577_0270078_507_965 134
103 3300042876 Ga0451577_0487700 Ga0451577_0487700_492_932 134
104 3300042876 Ga0451577_0848528 Ga0451577_0848528_330_794 134
105 3300042876 Ga0451577_1301736 Ga0451577_1301736_48_512 134
106 3300044673 Ga0453683_0132233 Ga0453683_0132233_1105_1554 134
107 3300044712 Ga0453684_0001716 Ga0453684_0001716_6692_7141 134
108 3300044712 Ga0453684_0010330 Ga0453684_0010330_2289_2735 134
109 3300044712 Ga0453684_0019504 Ga0453684_0019504_4735_5178 134
110 3300045051 Ga0451576_0001904 Ga0451576_0001904_28288_28731 134
111 3300045051 Ga0451576_0691563 Ga0451576_0691563_46_534 134
112 3300049522 Ga0501299_074106 Ga0501299_074106_188_640 134
113 3300049569 Ga0501032_0091582 Ga0501032_0091582_223_666 134
114 3300049571 Ga0501034_0000934 Ga0501034_0000934_15534_15977 134
115 3300049571 Ga0501034_0021911 Ga0501034_0021911_5211_5666 134
116 3300049571 Ga0501034_0619732 Ga0501034_0619732_494_934 134
117 3300049572 Ga0501036_0670103 Ga0501036_0670103_228_671 134
118 3300049574 Ga0501038_0086062 Ga0501038_0086062_1703_2146 134
119 3300049575 Ga0501039_0114583 Ga0501039_0114583_92_535 134
120 3300049579 Ga0501043_0043643 Ga0501043_0043643_1619_2062 134
121 3300049580 Ga0501046_0115319 Ga0501046_0115319_642_1085 134
122 3300049581 Ga0501047_0012044 Ga0501047_0012044_6808_7251 134
123 3300049583 Ga0501067_0004970 Ga0501067_0004970_5770_6213 134
124 3300049589 Ga0501073_0000001 Ga0501073_0000001_661646_662089 134
125 3300049590 Ga0501074_0049297 Ga0501074_0049297_975_1418 134
126 3300049742 Ga0501080_0000393 Ga0501080_0000393_24687_25130 134
127 3300049744 Ga0501083_0052645 Ga0501083_0052645_219_662 134
128 3300053153 Ga0500616_0000174 Ga0500616_0000174_94001_94474 134
129 3300060353 Ga0501082_0000387 Ga0501082_0000387_27603_28046 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

3

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f2n-assembly1.cif.gz_A crystal structure of ssb from klebsiella pneumonia. 0.9522 3 107
2vw9-assembly1.cif.gz_B-2 single stranded dna binding protein complex from helicobacter pylori 0.9514 3 106
6bhw-assembly2.cif.gz_G b. subtilis ssba 0.9501 3 105
5yyu-assembly1.cif.gz_D crystal structure of staphylococcus aureus single-stranded dna-binding protein ssbb 0.9458 3 107
7ym1-assembly1.cif.gz_B structure of ssba protein in complex with the anticancer drug 5-fluorouracil 0.9438 3 107
ID Description Score Start End Superfamily
2vw9B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9427 3 107 2.40.50.140
3ulpC00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9356 1 107 2.40.50.140
2iheA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9282 3 108 2.40.50.140
2vw9B00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9257 3 107 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9197 3 105 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7V3K344-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9772 3 108 GO:0003697
GO:0006260
GO:0009295
AF-A0A3M1B7B5-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9748 3 108 GO:0003697
GO:0006260
GO:0009295
AF-A0A7C6JDW6-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9724 3 110 GO:0003697
GO:0006260
GO:0009295
AF-A0A850FN32-F1-model_v4 deleted 0.9706 1 105
AF-A0A399YYZ5-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.9684 3 104 GO:0003697
GO:0006260
GO:0009295

Feature Viewer

pLDDT pTM Quality
85.04 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map