F139960

General Info

Members Datasets Scaffolds Average Seq Length
128 90 256 313

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2920107658|2920110374
Length 369
Sequence IIGGGGLVGSCAAFALQCGGIVSGLDLIDVNADLCKGQALDLLHGASLIADQRIRAVGYEAIPESDLVMITAGLRRKPDESRLDLINRNVELFLGILGNVKGAGLKKDAIVLVVSNPVDVLTYLALGQLGLPASQVIGLGTALDTARFRSLISEAVKLPPTQVTALILGEHGDSMVPIWSAAQAAGLPLDKFPGWSSSQADALFTRTKGSGAEVIKLKGGAGFAVGMAIREVVHAVALDSRRILPVSSLVSGIYGMRDVCTSVPTVVGRGGVLGQVEIELWGKEISALQQSSRVLRETIDLVLKGNPKAAGKPAPASSKPAAVAAPASKPVRVTMGAGGGGNGSGSSRVTISGIGNGNGNGHGKVTGGR

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
64 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
65 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
69 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
85 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
86 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
87 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
88 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
89 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
90 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0
Isolates 3.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 0
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10001363 3300005335 Bacteria 14834
2 Ga0070666_10019141 3300005335 Bacteria 4416
3 Ga0070660_100002866 3300005339 Bacteria 11879
4 Ga0070667_100201524 3300005367 Unclassified 1766
5 Ga0070667_100295226 3300005367 Unclassified 1458
6 Ga0070714_100247057 3300005435 Bacteria 1649
7 Ga0068867_100061465 3300005459 Bacteria 2789
8 Ga0070706_100083522 3300005467 Bacteria 2959
9 Ga0070706_100618281 3300005467 Bacteria 1006
10 Ga0070698_100193169 3300005471 Bacteria 1973
11 Ga0070698_100205983 3300005471 Bacteria 1902
12 Ga0068853_100052049 3300005539 Bacteria 3526
13 Ga0070686_100060280 3300005544 Bacteria 2448
14 Ga0070686_100138687 3300005544 Bacteria 1690
15 Ga0070665_100000297 3300005548 Bacteria 77862
16 Ga0070665_100473504 3300005548 Bacteria 1263
17 Ga0068857_100001400 3300005577 Bacteria 19042
18 Ga0068859_100167324 3300005617 Bacteria 2278
19 Ga0075364_10181363 3300006051 Bacteria 1425
20 Ga0097621_100010362 3300006237 Bacteria 6816
21 Ga0075428_100013536 3300006844 Bacteria 9081
22 Ga0075428_100119636 3300006844 Bacteria 2867
23 Ga0068865_100097011 3300006881 Unclassified 2151
24 Ga0097620_100167331 3300006931 Bacteria 2278
25 Ga0105240_10000230 3300009093 Bacteria 111150
26 Ga0105237_10000073 3300009545 Bacteria 134905
27 Ga0105249_10121299 3300009553 Bacteria 2484
28 Ga0105239_10001507 3300010375 Bacteria 30959
29 Ga0157370_10207907 3300013104 Bacteria 1814
30 Ga0157374_10033287 3300013296 Bacteria 4702
31 Ga0157374_10167666 3300013296 Bacteria 2141
32 Ga0157375_10508677 3300013308 Unclassified 1368
33 Ga0163163_10000091 3300014325 Bacteria 96507
34 Ga0163163_10295542 3300014325 Bacteria 1672
35 Ga0163163_10384170 3300014325 Bacteria 1462
36 Ga0157379_10160785 3300014968 Unclassified 2027
37 Ga0207680_10001067 3300025903 Bacteria 12932
38 Ga0207680_10076623 3300025903 Bacteria 2089
39 Ga0207695_10000335 3300025913 Bacteria 110801
40 Ga0207671_10000007 3300025914 Bacteria 825758
41 Ga0207657_10036469 3300025919 Bacteria 4400
42 Ga0207670_10008189 3300025936 Bacteria 5883
43 Ga0207670_10387123 3300025936 Bacteria 1115
44 Ga0207704_10085785 3300025938 Unclassified 2051
45 Ga0207658_10181777 3300025986 Unclassified 1741
46 Ga0207676_10143673 3300026095 Bacteria 2046
47 Ga0207676_10239066 3300026095 Bacteria 1628
48 Ga0207674_10012252 3300026116 Bacteria 9590
49 Ga0268266_10001071 3300028379 Bacteria 34328
50 Ga0268266_10410119 3300028379 Bacteria 1282
51 Ga0265337_1013551 3300028556 Bacteria 2730
52 Ga0265319_1002046 3300028563 Bacteria 11346
53 Ga0265319_1004457 3300028563 Bacteria 6925
54 Ga0265334_10035657 3300028573 Bacteria 1968
55 Ga0307515_10000005 3300028794 Bacteria 758563
56 Ga0307515_10079484 3300028794 Unclassified 4295
57 Ga0265338_10008416 3300028800 Bacteria 12528
58 Ga0265338_10048683 3300028800 Unclassified 3853
59 Ga0265332_10005999 3300031238 Bacteria 5555
60 Ga0265332_10035023 3300031238 Bacteria 2181
61 Ga0265328_10059604 3300031239 Bacteria 1401
62 Ga0265320_10002719 3300031240 Bacteria 12229
63 Ga0265320_10015058 3300031240 Bacteria 4379
64 Ga0265325_10000772 3300031241 Bacteria 23168
65 Ga0265325_10011447 3300031241 Bacteria 5099
66 Ga0265329_10000980 3300031242 Bacteria 14278
67 Ga0265339_10000234 3300031249 Bacteria 44984
68 Ga0265331_10000243 3300031250 Bacteria 65279
69 Ga0265313_10001225 3300031595 Bacteria 24498
70 Ga0265314_10000142 3300031711 Bacteria 108299
71 Ga0265314_10000470 3300031711 Bacteria 53501
72 Ga0265342_10004427 3300031712 Bacteria 11079
73 Ga0265342_10016849 3300031712 Bacteria 4764
74 Ga0373937_0604498 3300036401 Bacteria 1041
75 Ga0395905_0001806 3300037471 Bacteria 24776
76 Ga0436360_0121454 3300039438 Bacteria 1331
77 Ga0436361_0032747 3300039447 Bacteria 1818
78 Ga0451577_0074013 3300042876 Bacteria 3039
79 Ga0451577_0170290 3300042876 Bacteria 1962
80 Ga0453684_0000001 3300044712 Bacteria 2623166
81 Ga0453684_0354551 3300044712 Bacteria 1653
82 Ga0451576_0000251 3300045051 Bacteria 132099
83 Ga0451576_0001128 3300045051 Bacteria 48412
84 Ga0451576_0006189 3300045051 Bacteria 14739
85 Ga0495582_0034720 3300046473 Bacteria 2772
86 Ga0495630_0000019 3300046517 Bacteria 182603
87 Ga0495630_0290528 3300046517 Bacteria 1249
88 Ga0495643_0000131 3300046522 Bacteria 121697
89 Ga0495666_0009319 3300046526 Unclassified 4911
90 Ga0495665_0094908 3300046531 Bacteria 1566
91 Ga0495640_0044266 3300046533 Bacteria 3096
92 Ga0495586_0000442 3300046535 Bacteria 24932
93 Ga0495645_0080967 3300046543 Bacteria 2330
94 Ga0495634_0050197 3300046642 Bacteria 2803
95 Ga0495624_0073543 3300046690 Bacteria 2125
96 Ga0495674_0000154 3300047319 Bacteria 53023
97 Ga0501032_0044166 3300049569 Bacteria 3017
98 Ga0501033_0004272 3300049570 Bacteria 11484
99 Ga0501033_0040638 3300049570 Bacteria 3472
100 Ga0501034_0006823 3300049571 Bacteria 12214
101 Ga0501034_0007336 3300049571 Bacteria 11745
102 Ga0501034_0059503 3300049571 Bacteria 3837
103 Ga0501034_0128128 3300049571 Bacteria 2523
104 Ga0501034_0411012 3300049571 Bacteria 1275
105 Ga0501037_0062255 3300049573 Bacteria 2720
106 Ga0501042_0248384 3300049578 Unclassified 1284
107 Ga0501043_0036999 3300049579 Bacteria 3840
108 Ga0501046_0000164 3300049580 Bacteria 69259
109 Ga0501046_0006439 3300049580 Bacteria 10403
110 Ga0501046_0006685 3300049580 Bacteria 10185
111 Ga0501047_0039058 3300049581 Bacteria 4592
112 Ga0501047_0226474 3300049581 Bacteria 1724
113 Ga0501070_0001963 3300049586 Bacteria 18133
114 Ga0501070_0346636 3300049586 Bacteria 1206
115 Ga0501076_0137155 3300049592 Bacteria 1987
116 Ga0501035_0084517 3300049822 Bacteria 2799
117 Ga0501035_0148007 3300049822 Bacteria 2039
118 Ga0501044_0028588 3300049823 Bacteria 5885
119 Ga0501044_0144290 3300049823 Bacteria 2367
120 nmdc:mga0yw44_216114_c1 3300050492 Bacteria 1269
121 nmdc:mga0a205_99631_c1 3300050515 Unclassified 2804
122 Ga0495619_0016618 3300053085 Bacteria 4659
123 Ga0500616_0000259 3300053153 Bacteria 81482
124 2920110374 2920107658 Bacteria 10042636
125 2687238313 2684623219 Bacteria 8442773
126 2688067865 2687453257 Bacteria 6784659
127 2788433812 2786546940 Bacteria 6396474
128 2889420581 2889415604 Bacteria 8048700
129 Ga0070666_10001363
130 Ga0070666_10019141
131 Ga0070660_100002866
132 Ga0070667_100201524
133 Ga0070667_100295226
134 Ga0070714_100247057
135 Ga0068867_100061465
136 Ga0070706_100083522
137 Ga0070706_100618281
138 Ga0070698_100193169
139 Ga0070698_100205983
140 Ga0068853_100052049
141 Ga0070686_100060280
142 Ga0070686_100138687
143 Ga0070665_100000297
144 Ga0070665_100473504
145 Ga0068857_100001400
146 Ga0068859_100167324
147 Ga0075364_10181363
148 Ga0097621_100010362
149 Ga0075428_100013536
150 Ga0075428_100119636
151 Ga0068865_100097011
152 Ga0097620_100167331
153 Ga0105240_10000230
154 Ga0105237_10000073
155 Ga0105249_10121299
156 Ga0105239_10001507
157 Ga0157370_10207907
158 Ga0157374_10033287
159 Ga0157374_10167666
160 Ga0157375_10508677
161 Ga0163163_10000091
162 Ga0163163_10295542
163 Ga0163163_10384170
164 Ga0157379_10160785
165 Ga0207680_10001067
166 Ga0207680_10076623
167 Ga0207695_10000335
168 Ga0207671_10000007
169 Ga0207657_10036469
170 Ga0207670_10008189
171 Ga0207670_10387123
172 Ga0207704_10085785
173 Ga0207658_10181777
174 Ga0207676_10143673
175 Ga0207676_10239066
176 Ga0207674_10012252
177 Ga0268266_10001071
178 Ga0268266_10410119
179 Ga0265337_1013551
180 Ga0265319_1002046
181 Ga0265319_1004457
182 Ga0265334_10035657
183 Ga0307515_10000005
184 Ga0307515_10079484
185 Ga0265338_10008416
186 Ga0265338_10048683
187 Ga0265332_10005999
188 Ga0265332_10035023
189 Ga0265328_10059604
190 Ga0265320_10002719
191 Ga0265320_10015058
192 Ga0265325_10000772
193 Ga0265325_10011447
194 Ga0265329_10000980
195 Ga0265339_10000234
196 Ga0265331_10000243
197 Ga0265313_10001225
198 Ga0265314_10000142
199 Ga0265314_10000470
200 Ga0265342_10004427
201 Ga0265342_10016849
202 Ga0373937_0604498
203 Ga0395905_0001806
204 Ga0436360_0121454
205 Ga0436361_0032747
206 Ga0451577_0074013
207 Ga0451577_0170290
208 Ga0453684_0000001
209 Ga0453684_0354551
210 Ga0451576_0000251
211 Ga0451576_0001128
212 Ga0451576_0006189
213 Ga0495582_0034720
214 Ga0495630_0000019
215 Ga0495630_0290528
216 Ga0495643_0000131
217 Ga0495666_0009319
218 Ga0495665_0094908
219 Ga0495640_0044266
220 Ga0495586_0000442
221 Ga0495645_0080967
222 Ga0495634_0050197
223 Ga0495624_0073543
224 Ga0495674_0000154
225 Ga0501032_0044166
226 Ga0501033_0004272
227 Ga0501033_0040638
228 Ga0501034_0006823
229 Ga0501034_0007336
230 Ga0501034_0059503
231 Ga0501034_0128128
232 Ga0501034_0411012
233 Ga0501037_0062255
234 Ga0501042_0248384
235 Ga0501043_0036999
236 Ga0501046_0000164
237 Ga0501046_0006439
238 Ga0501046_0006685
239 Ga0501047_0039058
240 Ga0501047_0226474
241 Ga0501070_0001963
242 Ga0501070_0346636
243 Ga0501076_0137155
244 Ga0501035_0084517
245 Ga0501035_0148007
246 Ga0501044_0028588
247 Ga0501044_0144290
248 nmdc:mga0yw44_216114_c1
249 nmdc:mga0a205_99631_c1
250 Ga0495619_0016618
251 Ga0500616_0000259
252 2920110374
253 2687238313
254 2688067865
255 2788433812
256 2889420581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

1

138

0.97

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

141

305

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jml-assembly2.cif.gz_D re-refined structure of r-state l-lactate dehydrogenase fromlactobacillus casei 0.9683 1 306
6j9t-assembly2.cif.gz_E complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate 0.9673 1 308
2ldb-assembly1.cif.gz_A structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase 0.9656 2 306
6j9s-assembly2.cif.gz_C penta mutant of lactobacillus casei lactate dehydrogenase 0.9613 1 304
6j9s-assembly2.cif.gz_D penta mutant of lactobacillus casei lactate dehydrogenase 0.9613 1 304
ID Description Score Start End Superfamily
1ldbA02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9733 146 306 3.90.110.10
1ldbA02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9609 146 306 3.90.110.10
2ewdB02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9554 147 307 3.90.110.10
4q3nA02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9549 146 307 3.90.110.10
1ez4A02 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9538 146 306 3.90.110.10
ID Description Score Start End GO Terms
AF-A0A7C7L087-F1-model_v4 Lactate/malate dehydrogenase C-terminal domain-containing protein 0.9935 111 308 GO:0004459
GO:0006089
GO:0006090
AF-E8R091-F1-model_v4 Malate dehydrogenase (NAD) (EC 1.1.1.37) 0.9832 1 307 GO:0004459
GO:0006089
GO:0006090
GO:0030060
AF-A0A2V2BW46-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9825 1 308 GO:0004459
GO:0006089
GO:0006090
AF-A0A3L7RMJ7-F1-model_v4 Lactate dehydrogenase 0.9792 1 201 GO:0004459
GO:0006089
GO:0006090
AF-A0A2V2BW46-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9762 1 308 GO:0004459
GO:0006089
GO:0006090

Map