F139726

General Info

Members Datasets Scaffolds Average Seq Length
128 116 256 141

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0001173|Ga0500635_0001173_3054_3566
Length 170
Sequence MYLLDTHVISELRKAKTGRCDPGVVRWASGVARQNLYMSAISLLELENSVGKAERKDKVQAAPLRTWLDEQVMNAFDGRILPVDSAVVKKRAALSPTDPKSERDALVAATAQVHGLVLVTRQTAAFKSARVKVFNPWGYTPEDELNDDNADWQQVAKTGPLWLKNLFLRF

Samples

Sample ID Description Type Environment
1 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
28 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
62 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
63 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
103 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
104 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
105 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
106 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
107 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
108 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
111 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
112 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
113 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
114 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
115 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
116 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 2.34
Rhizoplane 0.78
Rhizosphere 64.84
Stem 0
Stem Tuber 0
Unclassified 8.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500635_0001173 3300053080 Bacteria 6274
2 rootL2_10087897 3300003322 Bacteria 2209
3 rootH1_10244981 3300003323 Bacteria 1044
4 Ga0065165_1002451 3300005262 Bacteria 15679
5 Ga0070683_100132312 3300005329 Bacteria 2361
6 Ga0070713_100407936 3300005436 Bacteria 1270
7 Ga0070701_10895971 3300005438 Bacteria 612
8 Ga0070663_100107600 3300005455 Bacteria 2090
9 Ga0070681_11841964 3300005458 Unclassified 532
10 Ga0068852_100054083 3300005616 Bacteria 3459
11 Ga0068859_100133236 3300005617 Bacteria 2557
12 Ga0068862_100021211 3300005844 Bacteria 5430
13 Ga0081540_1004650 3300005983 Bacteria 10385
14 Ga0081539_10099641 3300005985 Bacteria 1483
15 Ga0075362_10092165 3300006177 Bacteria 1408
16 Ga0097620_100133228 3300006931 Bacteria 2557
17 Ga0105251_10000944 3300009011 Bacteria 25941
18 Ga0105250_10010324 3300009092 Bacteria 3892
19 Ga0105240_10005065 3300009093 Bacteria 19755
20 Ga0105247_10039119 3300009101 Bacteria 2897
21 Ga0105248_10175567 3300009177 Bacteria 2415
22 Ga0105248_11858981 3300009177 Bacteria 683
23 Ga0105237_10012813 3300009545 Bacteria 8819
24 Ga0105239_10206545 3300010375 Bacteria 2201
25 Ga0157370_10501125 3300013104 Bacteria 1115
26 Ga0163163_10118469 3300014325 Bacteria 2680
27 Ga0163163_10298250 3300014325 Bacteria 1664
28 Ga0157380_12084444 3300014326 Bacteria 630
29 Ga0183365_10001 3300015684 Bacteria 2090444
30 Ga0213873_10073935 3300021358 Bacteria 944
31 Ga0213872_10021268 3300021361 Bacteria 2988
32 Ga0213874_10019847 3300021377 Bacteria 1835
33 Ga0213876_10006362 3300021384 Bacteria 6434
34 Ga0213875_10167395 3300021388 Bacteria 1032
35 Ga0209758_1033112 3300025297 Bacteria 2083
36 Ga0207713_1000919 3300025735 Bacteria 26429
37 Ga0207710_10023324 3300025900 Bacteria 2659
38 Ga0207695_10004813 3300025913 Bacteria 18263
39 Ga0207671_10088972 3300025914 Bacteria 2323
40 Ga0207644_11096867 3300025931 Bacteria 669
41 Ga0207711_11614846 3300025941 Bacteria 592
42 Ga0207658_10004167 3300025986 Bacteria 10075
43 Ga0207678_10098657 3300026067 Bacteria 2496
44 Ga0207698_10245772 3300026142 Bacteria 1634
45 Ga0268265_10042617 3300028380 Bacteria 3369
46 Ga0307515_10000877 3300028794 Bacteria 69170
47 Ga0265324_10014193 3300029957 Bacteria 2952
48 Ga0307511_10000934 3300030521 Bacteria 30890
49 Ga0307512_10048738 3300030522 Bacteria 3426
50 Ga0265328_10000620 3300031239 Bacteria 16424
51 Ga0307408_100256984 3300031548 Bacteria 1444
52 Ga0307514_10000877 3300031649 Bacteria 47219
53 Ga0316579_10210995 3300031691 Bacteria 939
54 Ga0316576_10007659 3300031727 Bacteria 6812
55 Ga0316576_10319637 3300031727 Bacteria 1158
56 Ga0307410_10462381 3300031852 Bacteria 1037
57 Ga0307412_10000210 3300031911 Bacteria 39741
58 Ga0307412_11116347 3300031911 Bacteria 702
59 Ga0307416_101961101 3300032002 Bacteria 688
60 Ga0307416_102491605 3300032002 Bacteria 616
61 Ga0307510_10010001 3300033180 Bacteria 11272
62 Ga0316574_0315471 3300035398 Bacteria 993
63 Ga0316584_0355165 3300036712 Unclassified 1052
64 Ga0395905_0210459 3300037471 Bacteria 1822
65 Ga0436364_0075629 3300037853 Bacteria 822
66 Ga0436364_0907770 3300037853 Bacteria 3702
67 Ga0400485_09396 3300038735 Bacteria 1717
68 Ga0400486_26219 3300038742 Unclassified 2670
69 Ga0400487_39332 3300039110 Bacteria 1040
70 Ga0400487_63942 3300039110 Bacteria 1776
71 Ga0436365_0100977 3300039437 Bacteria 4332
72 Ga0436365_0440052 3300039437 Bacteria 2020
73 Ga0436365_0738876 3300039437 Bacteria 1106
74 Ga0436365_1472601 3300039437 Unclassified 607
75 Ga0436360_1055763 3300039438 Bacteria 6912
76 Ga0436361_0490742 3300039447 Bacteria 7785
77 Ga0436361_0734178 3300039447 Bacteria 940
78 Ga0436363_0757444 3300039450 Bacteria 1472
79 Ga0436362_0790008 3300039453 Bacteria 8589
80 Ga0451800_0572883 3300041459 Bacteria 728
81 Ga0439455_0009263 3300042012 Bacteria 2131
82 Ga0466961_0930707 3300044693 Bacteria 517
83 Ga0495638_0000410 3300046460 Bacteria 52445
84 Ga0495580_0197977 3300046472 Bacteria 1385
85 Ga0495585_0134759 3300046492 Bacteria 1297
86 Ga0495594_0190533 3300046499 Unclassified 1168
87 Ga0495607_0000591 3300046501 Bacteria 35367
88 Ga0495618_0671097 3300046514 Bacteria 612
89 Ga0495628_0398528 3300046516 Bacteria 1006
90 Ga0495666_0030638 3300046526 Plasmid 2638
91 Ga0495665_0085906 3300046531 Unclassified 1654
92 Ga0495587_0632727 3300046536 Bacteria 588
93 Ga0495670_0481497 3300046691 Bacteria 673
94 Ga0495660_0473088 3300046810 Bacteria 539
95 Ga0495604_0008650 3300047317 Bacteria 8047
96 Ga0495687_000388 3300047443 Bacteria 54492
97 Ga0495681_0096289 3300047470 Bacteria 1300
98 Ga0495602_0450695 3300048088 Bacteria 908
99 Ga0496119_0165438 3300048922 Bacteria 1172
100 Ga0496120_0057890 3300048923 Bacteria 2179
101 Ga0496124_0000071 3300048927 Bacteria 220642
102 Ga0496126_0098388 3300048929 Bacteria 2563
103 Ga0501033_0005044 3300049570 Bacteria 10514
104 Ga0501034_0122037 3300049571 Bacteria 2592
105 Ga0501039_0584244 3300049575 Unclassified 876
106 Ga0501043_0278601 3300049579 Bacteria 1282
107 Ga0501047_0272024 3300049581 Bacteria 1540
108 Ga0501068_0200499 3300049584 Bacteria 1265
109 Ga0501071_0557582 3300049587 Unclassified 880
110 Ga0501073_0122896 3300049589 Bacteria 1799
111 Ga0501080_0093797 3300049742 Bacteria 2787
112 Ga0501080_0777884 3300049742 Unclassified 841
113 Ga0501044_0035400 3300049823 Bacteria 5228
114 Ga0500556_0033163 3300053104 Bacteria 1769
115 Ga0500572_012833 3300053111 Bacteria 2061
116 Ga0500608_000888 3300053122 Bacteria 10799
117 Ga0500618_000452 3300053125 Bacteria 26804
118 Ga0500655_060278 3300053133 Bacteria 764
119 Ga0500559_0056762 3300053136 Unclassified 1738
120 Ga0500564_000642 3300053138 Bacteria 10745
121 Ga0500568_0261029 3300053139 Unclassified 630
122 Ga0500574_000014 3300053141 Bacteria 43937
123 2757571660 2757320392 Bacteria 3737298
124 2904579506 2904578770 Bacteria 5302906
125 2919120829 2919119836 Bacteria 5208557
126 2928969900 2928968154 Bacteria 4633371
127 3005723711 3005718088 Bacteria 8283608
128 8056970440 8056967851 Bacteria 9038162
129 Ga0500635_0001173
130 rootL2_10087897
131 rootH1_10244981
132 Ga0065165_1002451
133 Ga0070683_100132312
134 Ga0070713_100407936
135 Ga0070701_10895971
136 Ga0070663_100107600
137 Ga0070681_11841964
138 Ga0068852_100054083
139 Ga0068859_100133236
140 Ga0068862_100021211
141 Ga0081540_1004650
142 Ga0081539_10099641
143 Ga0075362_10092165
144 Ga0097620_100133228
145 Ga0105251_10000944
146 Ga0105250_10010324
147 Ga0105240_10005065
148 Ga0105247_10039119
149 Ga0105248_10175567
150 Ga0105248_11858981
151 Ga0105237_10012813
152 Ga0105239_10206545
153 Ga0157370_10501125
154 Ga0163163_10118469
155 Ga0163163_10298250
156 Ga0157380_12084444
157 Ga0183365_10001
158 Ga0213873_10073935
159 Ga0213872_10021268
160 Ga0213874_10019847
161 Ga0213876_10006362
162 Ga0213875_10167395
163 Ga0209758_1033112
164 Ga0207713_1000919
165 Ga0207710_10023324
166 Ga0207695_10004813
167 Ga0207671_10088972
168 Ga0207644_11096867
169 Ga0207711_11614846
170 Ga0207658_10004167
171 Ga0207678_10098657
172 Ga0207698_10245772
173 Ga0268265_10042617
174 Ga0307515_10000877
175 Ga0265324_10014193
176 Ga0307511_10000934
177 Ga0307512_10048738
178 Ga0265328_10000620
179 Ga0307408_100256984
180 Ga0307514_10000877
181 Ga0316579_10210995
182 Ga0316576_10007659
183 Ga0316576_10319637
184 Ga0307410_10462381
185 Ga0307412_10000210
186 Ga0307412_11116347
187 Ga0307416_101961101
188 Ga0307416_102491605
189 Ga0307510_10010001
190 Ga0316574_0315471
191 Ga0316584_0355165
192 Ga0395905_0210459
193 Ga0436364_0075629
194 Ga0436364_0907770
195 Ga0400485_09396
196 Ga0400486_26219
197 Ga0400487_39332
198 Ga0400487_63942
199 Ga0436365_0100977
200 Ga0436365_0440052
201 Ga0436365_0738876
202 Ga0436365_1472601
203 Ga0436360_1055763
204 Ga0436361_0490742
205 Ga0436361_0734178
206 Ga0436363_0757444
207 Ga0436362_0790008
208 Ga0451800_0572883
209 Ga0439455_0009263
210 Ga0466961_0930707
211 Ga0495638_0000410
212 Ga0495580_0197977
213 Ga0495585_0134759
214 Ga0495594_0190533
215 Ga0495607_0000591
216 Ga0495618_0671097
217 Ga0495628_0398528
218 Ga0495666_0030638
219 Ga0495665_0085906
220 Ga0495587_0632727
221 Ga0495670_0481497
222 Ga0495660_0473088
223 Ga0495604_0008650
224 Ga0495687_000388
225 Ga0495681_0096289
226 Ga0495602_0450695
227 Ga0496119_0165438
228 Ga0496120_0057890
229 Ga0496124_0000071
230 Ga0496126_0098388
231 Ga0501033_0005044
232 Ga0501034_0122037
233 Ga0501039_0584244
234 Ga0501043_0278601
235 Ga0501047_0272024
236 Ga0501068_0200499
237 Ga0501071_0557582
238 Ga0501073_0122896
239 Ga0501080_0093797
240 Ga0501080_0777884
241 Ga0501044_0035400
242 Ga0500556_0033163
243 Ga0500572_012833
244 Ga0500608_000888
245 Ga0500618_000452
246 Ga0500655_060278
247 Ga0500559_0056762
248 Ga0500564_000642
249 Ga0500568_0261029
250 Ga0500574_000014
251 2757571660
252 2904579506
253 2919120829
254 2928969900
255 3005723711
256 8056970440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

131

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.8785 1 139
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.8726 1 139
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.8417 1 142
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.8305 1 142
5k8j-assembly1.cif.gz_B structure of caulobacter crescentus vapbc1 (apo form) 0.8171 1 135
ID Description Score Start End Superfamily
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8754 1 77 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8456 1 141 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8232 1 141 3.40.50.1010
5k8jC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8223 1 135 3.40.50.1010
5k8jC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8104 1 135 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A539EAD0-F1-model_v4 Putative plasmid stability protein 0.976 1 85 GO:0016020
AF-A0A8B0HY35-F1-model_v4 deleted 0.9622 2 139
AF-A0A1V3IB19-F1-model_v4 VapC toxin family PIN domain ribonuclease 0.9618 1 137 GO:0004518
GO:0046872
AF-A0A379QDV6-F1-model_v4 Uncharacterized protein 0.9616 1 71
AF-V5C3V3-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.961 1 134 GO:0000287
GO:0004540
GO:0090729

Map