F139529

General Info

Members Datasets Scaffolds Average Seq Length
128 97 122 211

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0034976|Ga0501034_0034976_1158_1883
Length 241
Sequence MTSPRSTTTSADPRPEAGPLSRPTAGRPLLIGIAGGSGSGKTTVAHRVRDALPKGTVSILEHDAYYRDRPDLTFEERCLINFDHPDALETELCLAHLEELRRGAGIDAPLYDFRTHRRAAETRRVEPASIVVLEGILVFVDAGLRDRLDLKIFVDTDPDIRAFRRIRRDLEQRGRTFDSIREQYYRTVRPMHLQFVEPSKRWADLILPEGGFNHVGVEAVVEMVRGAAHRVGAPLGRAASA

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
4 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
5 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
6 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
37 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
80 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.56
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10023230 3300005290 Bacteria 1101
2 Ga0070691_10229252 3300005341 Bacteria 988
3 Ga0070661_100052603 3300005344 Bacteria 2981
4 Ga0070706_100028918 3300005467 Bacteria 5105
5 Ga0070699_100026093 3300005518 Bacteria 5039
6 Ga0070696_100052798 3300005546 Bacteria 2828
7 Ga0070704_100292579 3300005549 Bacteria 1354
8 Ga0068855_100103837 3300005563 Bacteria 3269
9 Ga0070664_100022545 3300005564 Bacteria 5193
10 Ga0068854_100062483 3300005578 Bacteria 2700
11 Ga0068852_100589032 3300005616 Bacteria 1116
12 Ga0068863_100036079 3300005841 Bacteria 4708
13 Ga0068860_100006061 3300005843 Bacteria 12169
14 Ga0075364_10136190 3300006051 Bacteria 1650
15 Ga0075366_10288183 3300006195 Bacteria 1004
16 Ga0075428_100116428 3300006844 Bacteria 2911
17 Ga0075430_100080891 3300006846 Bacteria 2721
18 Ga0075431_100032669 3300006847 Bacteria 5363
19 Ga0075431_100064357 3300006847 Bacteria 3786
20 Ga0075431_100401275 3300006847 Bacteria 1372
21 Ga0075433_10020266 3300006852 Bacteria 5557
22 Ga0075433_10030694 3300006852 Bacteria 4587
23 Ga0075429_100089580 3300006880 Bacteria 2682
24 Ga0097620_100196915 3300006931 Bacteria 2099
25 Ga0075435_100052280 3300007076 Bacteria 3293
26 Ga0075435_100096168 3300007076 Bacteria 2450
27 Ga0099794_10003504 3300007265 Bacteria 6004
28 Ga0099795_10133058 3300007788 Bacteria 1005
29 Ga0111539_10069598 3300009094 Bacteria 4155
30 Ga0111539_10103307 3300009094 Bacteria 3345
31 Ga0105247_10266617 3300009101 Bacteria 1176
32 Ga0114129_10002258 3300009147 Bacteria 26634
33 Ga0114129_10627650 3300009147 Bacteria 1389
34 Ga0105241_10053283 3300009174 Bacteria 3093
35 Ga0105249_10434312 3300009553 Bacteria 1349
36 Ga0105030_101066 3300009987 Bacteria 2435
37 Ga0105028_100286 3300009993 Bacteria 5482
38 Ga0157373_10010057 3300013100 Bacteria 6971
39 Ga0157372_10024526 3300013307 Bacteria 6554
40 Ga0207707_10274004 3300025912 Bacteria 1462
41 Ga0207652_10166748 3300025921 Bacteria 1975
42 Ga0207661_10191432 3300025944 Bacteria 1793
43 Ga0207661_10312534 3300025944 Bacteria 1411
44 Ga0207679_10134628 3300025945 Bacteria 1988
45 Ga0207667_10129751 3300025949 Bacteria 2596
46 Ga0207639_10109986 3300026041 Bacteria 2244
47 Ga0207641_10038915 3300026088 Bacteria 3976
48 Ga0207698_10524380 3300026142 Bacteria 1157
49 Ga0209588_1023628 3300027671 Bacteria 1938
50 Ga0265319_1052730 3300028563 Bacteria 1338
51 Ga0265322_10000066 3300028654 Bacteria 51953
52 Ga0265338_10010553 3300028800 Bacteria 10804
53 Ga0265330_10072923 3300031235 Bacteria 1484
54 Ga0265328_10016640 3300031239 Bacteria 2857
55 Ga0265320_10020974 3300031240 Bacteria 3526
56 Ga0265316_10008097 3300031344 Bacteria 9796
57 Ga0307408_100582405 3300031548 Bacteria 992
58 Ga0316575_10005226 3300031665 Bacteria 4619
59 Ga0316575_10011576 3300031665 Bacteria 3266
60 Ga0316579_10021530 3300031691 Bacteria 2874
61 Ga0265314_10022082 3300031711 Bacteria 4879
62 Ga0316576_10023128 3300031727 Bacteria 4325
63 Ga0316576_10208003 3300031727 Bacteria 1473
64 Ga0316576_10246948 3300031727 Unclassified 1340
65 Ga0316578_10014677 3300031728 Bacteria 4192
66 Ga0316578_10060001 3300031728 Unclassified 2238
67 Ga0316578_10105257 3300031728 Bacteria 1693
68 Ga0316577_10022101 3300031733 Unclassified 3532
69 Ga0307412_10556892 3300031911 Bacteria 964
70 Ga0307409_100468825 3300031995 Bacteria 1219
71 Ga0307416_100397183 3300032002 Bacteria 1415
72 Ga0307416_101100212 3300032002 Bacteria 899
73 Ga0316585_10003250 3300032137 Bacteria 4454
74 Ga0316574_0003588 3300035398 Bacteria 8028
75 Ga0316574_0023573 3300035398 Bacteria 3675
76 Ga0373931_0048364 3300035691 Bacteria 2255
77 Ga0373927_0017995 3300035695 Bacteria 4648
78 Ga0316582_0041703 3300036647 Bacteria 2870
79 Ga0316582_0160037 3300036647 Bacteria 1525
80 Ga0316582_0364503 3300036647 Unclassified 994
81 Ga0316584_0021914 3300036712 Unclassified 4652
82 Ga0316584_0036434 3300036712 Bacteria 3650
83 Ga0373925_0025904 3300037068 Bacteria 4288
84 Ga0400486_16497 3300038742 Bacteria 1992
85 Ga0451577_0012962 3300042876 Bacteria 7820
86 Ga0451577_0087275 3300042876 Bacteria 2784
87 Ga0451577_0505330 3300042876 Bacteria 1097
88 Ga0451577_0767055 3300042876 Bacteria 872
89 Ga0453683_0042528 3300044673 Bacteria 2852
90 Ga0453684_0052728 3300044712 Bacteria 5315
91 Ga0453684_0139996 3300044712 Bacteria 2891
92 Ga0453684_0270206 3300044712 Bacteria 1943
93 Ga0453684_0275935 3300044712 Bacteria 1919
94 Ga0466957_0379799 3300044842 Bacteria 963
95 Ga0451576_0004952 3300045051 Bacteria 16946
96 Ga0451576_0028103 3300045051 Bacteria 6030
97 Ga0451576_0028145 3300045051 Bacteria 6025
98 Ga0451576_0041998 3300045051 Bacteria 4829
99 Ga0451576_0125550 3300045051 Bacteria 2674
100 Ga0495620_0213963 3300046515 Bacteria 739
101 Ga0495615_0014415 3300048090 Bacteria 1670
102 Ga0496100_0214685 3300048903 Bacteria 1409
103 Ga0496109_0241715 3300048912 Bacteria 1699
104 Ga0501034_0034976 3300049571 Bacteria 5095
105 Ga0501034_0192048 3300049571 Bacteria 2004
106 Ga0501034_0619454 3300049571 Bacteria 986
107 Ga0501040_0135568 3300049576 Bacteria 1733
108 Ga0501071_0636222 3300049587 Bacteria 821
109 Ga0501076_0753064 3300049592 Bacteria 804
110 Ga0501081_0215554 3300049743 Bacteria 1395
111 Ga0501083_0084322 3300049744 Bacteria 2104
112 Ga0501035_0000087 3300049822 Bacteria 115716
113 nmdc:mga05p37_62255_c1 3300050507 Bacteria 4592
114 nmdc:mga0qj67_120824_c1 3300050509 Bacteria 2119
115 nmdc:mga06r32_51864_c1 3300050510 Bacteria 3927
116 nmdc:mga08y16_55744_c1 3300050511 Bacteria 4130
117 nmdc:mga0n895_1328468_c1 3300050512 Bacteria 689
118 nmdc:mga0n895_209881_c1 3300050512 Bacteria 1978
119 nmdc:mga0rr50_480933_c1 3300050513 Bacteria 1055
120 nmdc:mga08x19_524855_c1 3300050514 Bacteria 837
121 nmdc:mga0a205_22042_c1 3300050515 Bacteria 6029
122 nmdc:mga0a205_687361_c1 3300050515 Bacteria 873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0017995 Ga0373927_0017995_2230_2847 195
2 3300037068 Ga0373925_0025904 Ga0373925_0025904_2218_2835 195
3 3300042876 Ga0451577_0087275 Ga0451577_0087275_1268_1867 199
4 3300031665 Ga0316575_10005226 Ga0316575_100052265 200
5 3300031691 Ga0316579_10021530 Ga0316579_100215304 200
6 3300031727 Ga0316576_10023128 Ga0316576_100231285 200
7 3300031728 Ga0316578_10014677 Ga0316578_100146775 200
8 3300032137 Ga0316585_10003250 Ga0316585_100032502 200
9 3300035398 Ga0316574_0023573 Ga0316574_0023573_1190_1804 200
10 3300036647 Ga0316582_0041703 Ga0316582_0041703_1871_2485 200
11 3300036712 Ga0316584_0036434 Ga0316584_0036434_1941_2555 200
12 3300045051 Ga0451576_0028145 Ga0451576_0028145_387_1001 200
13 iso_pu_bacteria 2524614857 2526063982 200
14 iso_pu_bacteria 2739367875 2740061560 200
15 3300048912 Ga0496109_0241715 Ga0496109_0241715_934_1551 201
16 3300005467 Ga0070706_100028918 Ga0070706_1000289182 202
17 3300031235 Ga0265330_10072923 Ga0265330_100729232 202
18 3300031344 Ga0265316_10008097 Ga0265316_100080976 202
19 3300031728 Ga0316578_10060001 Ga0316578_100600012 202
20 3300036647 Ga0316582_0160037 Ga0316582_0160037_125_754 202
21 3300038742 Ga0400486_16497 Ga0400486_16497_1235_1867 202
22 3300042876 Ga0451577_0767055 Ga0451577_0767055_167_787 202
23 3300044712 Ga0453684_0139996 Ga0453684_0139996_2171_2815 202
24 3300009147 Ga0114129_10627650 Ga0114129_106276502 203
25 3300045051 Ga0451576_0004952 Ga0451576_0004952_300_926 203
26 3300049587 Ga0501071_0636222 Ga0501071_0636222_40_660 203
27 3300050514 nmdc:mga08x19_524855_c1 nmdc:mga08x19_524855_c1_192_827 203
28 3300050515 nmdc:mga0a205_687361_c1 nmdc:mga0a205_687361_c1_217_837 203
29 3300005843 Ga0068860_100006061 Ga0068860_1000060617 204
30 3300006847 Ga0075431_100401275 Ga0075431_1004012751 204
31 3300006852 Ga0075433_10030694 Ga0075433_100306945 204
32 3300007076 Ga0075435_100052280 Ga0075435_1000522802 204
33 3300007076 Ga0075435_100096168 Ga0075435_1000961681 204
34 3300007265 Ga0099794_10003504 Ga0099794_100035047 204
35 3300007788 Ga0099795_10133058 Ga0099795_101330582 204
36 3300009101 Ga0105247_10266617 Ga0105247_102666172 204
37 3300009147 Ga0114129_10002258 Ga0114129_100022582 204
38 3300009553 Ga0105249_10434312 Ga0105249_104343122 204
39 3300027671 Ga0209588_1023628 Ga0209588_10236282 204
40 3300028563 Ga0265319_1052730 Ga0265319_10527301 204
41 3300028800 Ga0265338_10010553 Ga0265338_100105537 204
42 3300031239 Ga0265328_10016640 Ga0265328_100166402 204
43 3300031240 Ga0265320_10020974 Ga0265320_100209742 204
44 3300031665 Ga0316575_10011576 Ga0316575_100115765 204
45 3300031711 Ga0265314_10022082 Ga0265314_100220823 204
46 3300031727 Ga0316576_10246948 Ga0316576_102469481 204
47 3300031728 Ga0316578_10105257 Ga0316578_101052573 204
48 3300031733 Ga0316577_10022101 Ga0316577_100221015 204
49 3300035398 Ga0316574_0003588 Ga0316574_0003588_6942_7565 204
50 3300036647 Ga0316582_0364503 Ga0316582_0364503_127_750 204
51 3300036712 Ga0316584_0021914 Ga0316584_0021914_3948_4571 204
52 3300044712 Ga0453684_0270206 Ga0453684_0270206_1206_1835 204
53 3300044712 Ga0453684_0275935 Ga0453684_0275935_1268_1897 204
54 3300045051 Ga0451576_0041998 Ga0451576_0041998_1884_2510 204
55 3300050507 nmdc:mga05p37_62255_c1 nmdc:mga05p37_62255_c1_3262_3900 204
56 3300050512 nmdc:mga0n895_1328468_c1 nmdc:mga0n895_1328468_c1_22_654 204
57 3300050513 nmdc:mga0rr50_480933_c1 nmdc:mga0rr50_480933_c1_301_933 204
58 3300005341 Ga0070691_10229252 Ga0070691_102292521 205
59 3300005344 Ga0070661_100052603 Ga0070661_1000526032 205
60 3300005518 Ga0070699_100026093 Ga0070699_1000260933 205
61 3300005546 Ga0070696_100052798 Ga0070696_1000527983 205
62 3300005563 Ga0068855_100103837 Ga0068855_1001038372 205
63 3300005578 Ga0068854_100062483 Ga0068854_1000624833 205
64 3300005616 Ga0068852_100589032 Ga0068852_1005890322 205
65 3300006195 Ga0075366_10288183 Ga0075366_102881832 205
66 3300006846 Ga0075430_100080891 Ga0075430_1000808913 205
67 3300006847 Ga0075431_100032669 Ga0075431_1000326692 205
68 3300006847 Ga0075431_100064357 Ga0075431_1000643573 205
69 3300006880 Ga0075429_100089580 Ga0075429_1000895803 205
70 3300009174 Ga0105241_10053283 Ga0105241_100532832 205
71 3300013100 Ga0157373_10010057 Ga0157373_100100579 205
72 3300013307 Ga0157372_10024526 Ga0157372_100245268 205
73 3300025912 Ga0207707_10274004 Ga0207707_102740043 205
74 3300025921 Ga0207652_10166748 Ga0207652_101667483 205
75 3300025944 Ga0207661_10191432 Ga0207661_101914323 205
76 3300025949 Ga0207667_10129751 Ga0207667_101297512 205
77 3300026041 Ga0207639_10109986 Ga0207639_101099862 205
78 3300026142 Ga0207698_10524380 Ga0207698_105243802 205
79 3300028654 Ga0265322_10000066 Ga0265322_100000665 205
80 3300031911 Ga0307412_10556892 Ga0307412_105568921 205
81 3300032002 Ga0307416_100397183 Ga0307416_1003971832 205
82 3300035691 Ga0373931_0048364 Ga0373931_0048364_654_1334 205
83 3300045051 Ga0451576_0125550 Ga0451576_0125550_1380_2009 205
84 3300046515 Ga0495620_0213963 Ga0495620_0213963_30_659 205
85 3300049571 Ga0501034_0192048 Ga0501034_0192048_805_1431 205
86 3300049571 Ga0501034_0619454 Ga0501034_0619454_58_690 205
87 3300049576 Ga0501040_0135568 Ga0501040_0135568_121_747 205
88 3300050509 nmdc:mga0qj67_120824_c1 nmdc:mga0qj67_120824_c1_357_1127 205
89 3300050510 nmdc:mga06r32_51864_c1 nmdc:mga06r32_51864_c1_3276_3902 205
90 3300005841 Ga0068863_100036079 Ga0068863_1000360795 206
91 3300006051 Ga0075364_10136190 Ga0075364_101361902 206
92 3300009987 Ga0105030_101066 Ga0105030_1010662 206
93 3300009993 Ga0105028_100286 Ga0105028_1002862 206
94 3300026088 Ga0207641_10038915 Ga0207641_100389153 206
95 3300031727 Ga0316576_10208003 Ga0316576_102080032 206
96 3300044842 Ga0466957_0379799 Ga0466957_0379799_306_938 206
97 iso_pu_bacteria 3001267043 3001268479 206
98 iso_pu_bacteria 3001272096 3001273949 206
99 iso_pu_bacteria 3006988479 3006988884 206
100 3300006931 Ga0097620_100196915 Ga0097620_1001969152 207
101 3300031548 Ga0307408_100582405 Ga0307408_1005824051 207
102 3300031995 Ga0307409_100468825 Ga0307409_1004688252 207
103 3300032002 Ga0307416_101100212 Ga0307416_1011002122 207
104 3300042876 Ga0451577_0012962 Ga0451577_0012962_4068_4706 207
105 3300044673 Ga0453683_0042528 Ga0453683_0042528_332_970 207
106 3300045051 Ga0451576_0028103 Ga0451576_0028103_4761_5399 207
107 3300048090 Ga0495615_0014415 Ga0495615_0014415_550_1185 207
108 3300049822 Ga0501035_0000087 Ga0501035_0000087_39421_40056 207
109 3300005549 Ga0070704_100292579 Ga0070704_1002925792 208
110 3300006844 Ga0075428_100116428 Ga0075428_1001164282 208
111 3300009094 Ga0111539_10069598 Ga0111539_100695985 208
112 3300042876 Ga0451577_0505330 Ga0451577_0505330_165_812 208
113 3300044712 Ga0453684_0052728 Ga0453684_0052728_807_1454 208
114 3300048903 Ga0496100_0214685 Ga0496100_0214685_320_958 208
115 3300049743 Ga0501081_0215554 Ga0501081_0215554_174_812 208
116 3300050511 nmdc:mga08y16_55744_c1 nmdc:mga08y16_55744_c1_3386_4033 208
117 iso_pu_bacteria 2916971899 2916973655 208
118 3300049592 Ga0501076_0753064 Ga0501076_0753064_150_788 209
119 3300005564 Ga0070664_100022545 Ga0070664_1000225456 210
120 3300025944 Ga0207661_10312534 Ga0207661_103125343 210
121 3300025945 Ga0207679_10134628 Ga0207679_101346282 210
122 3300005290 Ga0065712_10023230 Ga0065712_100232302 211
123 3300006852 Ga0075433_10020266 Ga0075433_100202665 211
124 3300009094 Ga0111539_10103307 Ga0111539_101033072 211
125 3300049571 Ga0501034_0034976 Ga0501034_0034976_1158_1883 211
126 3300049744 Ga0501083_0084322 Ga0501083_0084322_1118_1825 211
127 3300050512 nmdc:mga0n895_209881_c1 nmdc:mga0n895_209881_c1_928_1575 211
128 3300050515 nmdc:mga0a205_22042_c1 nmdc:mga0a205_22042_c1_3262_3909 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00485

PRK

Phosphoribulokinase / Uridine kinase family

30

216

0.92

PF06414

Zeta_toxin

Zeta toxin

17

73

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w34-assembly1.cif.gz_A ternary complex of thermus thermophilus hb8 uridine-cytidine kinase with substrates 0.9562 1 201
3w8r-assembly1.cif.gz_B mutant structure of thermus thermophilus hb8 uridine-cytidine kinase 0.9559 1 201
6n55-assembly1.cif.gz_H crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine 0.9446 1 199
1uei-assembly2.cif.gz_B crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, utp 0.9442 1 199
6n53-assembly1.cif.gz_A-2 crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine monophosphate 0.9433 2 198
ID Description Score Start End Superfamily
af_Q2FXW6_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9785 1 196 3.40.50.300
af_P0A8F4_7_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9753 1 196 3.40.50.300
af_I1JJM2_43_250_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9663 1 199 3.40.50.300
af_Q5ANN6_93_307_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9397 2 209 3.40.50.300
af_Q17413_7_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9379 2 206 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W1QU72-F1-model_v4 Uridine kinase 0.9958 1 113 GO:0005524
GO:0016301
AF-A0A7V8VUW1-F1-model_v4 uridine/cytidine kinase (EC 2.7.1.48) 0.9931 1 140 GO:0004849
GO:0005524
GO:0044206
AF-A0A2E0THS1-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.991 1 196 GO:0004849
GO:0005524
GO:0005737
GO:0043771
GO:0044206
GO:0044211
AF-A0A7W1QU72-F1-model_v4 Uridine kinase 0.9871 1 113 GO:0005524
GO:0016301
AF-A0A4V1K2P7-F1-model_v4 deleted 0.9859 1 196

Feature Viewer

pLDDT pTM Quality
89.79 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map