F139288

General Info

Members Datasets Scaffolds Average Seq Length
128 110 127 168

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0000803|Ga0495613_0000803_19045_19641
Length 198
Sequence MACGHASDFDPILVGSKSDARQPEDGLARYSVLAIADVLPDILRPGLRIVFCGTAAGSASARAGAYYAGPGNAFWATLHSTGLTPVPLSPSEFERLPEFGIGLTDVCKVLHGSDREVGTVEFDVSGLETRIADAEPGNLAFNGKNAARAALDRAVGYGLQPERIGGAAVWVLPSTSGAARRFWDVEPWQELARADANR

Samples

Sample ID Description Type Environment
1 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
24 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
37 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
55 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
109 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 8.59
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10017250 3300003320 Bacteria 2054
2 rootH1_10112278 3300003323 Bacteria 3157
3 Ga0070683_100010698 3300005329 Bacteria 7890
4 Ga0070666_10018097 3300005335 Bacteria 4525
5 Ga0070674_100000016 3300005356 Bacteria 91058
6 Ga0070667_100197773 3300005367 Bacteria 1783
7 Ga0070667_100323504 3300005367 Bacteria 1392
8 Ga0070714_100017531 3300005435 Bacteria 5802
9 Ga0070694_100608804 3300005444 Unclassified 880
10 Ga0070663_100288220 3300005455 Bacteria 1311
11 Ga0070684_100014270 3300005535 Bacteria 6429
12 Ga0070665_100056603 3300005548 Bacteria 3931
13 Ga0068861_100133694 3300005719 Bacteria 2016
14 Ga0068863_100131783 3300005841 Bacteria 2387
15 Ga0068858_100021740 3300005842 Bacteria 5994
16 Ga0068862_100873093 3300005844 Bacteria 883
17 Ga0068865_101130338 3300006881 Bacteria 691
18 Ga0105237_11160517 3300009545 Bacteria 779
19 Ga0105238_10000011 3300009551 Bacteria 261080
20 Ga0105239_10092794 3300010375 Bacteria 3333
21 Ga0157370_10029972 3300013104 Bacteria 5333
22 Ga0157375_10046837 3300013308 Bacteria 4219
23 Ga0157375_10654522 3300013308 Bacteria 1207
24 Ga0183365_10004 3300015684 Bacteria 333304
25 Ga0207680_10019823 3300025903 Bacteria 3606
26 Ga0207680_10164860 3300025903 Bacteria 1489
27 Ga0207694_10000004 3300025924 Bacteria 967075
28 Ga0207664_10080689 3300025929 Bacteria 2645
29 Ga0207644_10605354 3300025931 Bacteria 910
30 Ga0207706_10000026 3300025933 Bacteria 149379
31 Ga0207661_10002763 3300025944 Bacteria 12090
32 Ga0207658_10039233 3300025986 Bacteria 3416
33 Ga0207658_10263418 3300025986 Bacteria 1470
34 Ga0207703_10130871 3300026035 Bacteria 2166
35 Ga0207678_10293879 3300026067 Bacteria 1396
36 Ga0207641_10217806 3300026088 Bacteria 1769
37 Ga0207675_100180767 3300026118 Bacteria 2020
38 Ga0268266_10000085 3300028379 Bacteria 201288
39 Ga0265337_1000007 3300028556 Bacteria 98412
40 Ga0265326_10000019 3300028558 Bacteria 137370
41 Ga0265319_1000014 3300028563 Bacteria 177623
42 Ga0265318_10120260 3300028577 Unclassified 966
43 Ga0265322_10000011 3300028654 Bacteria 167597
44 Ga0265322_10065959 3300028654 Bacteria 1026
45 Ga0265336_10051434 3300028666 Bacteria 1244
46 Ga0265338_10000244 3300028800 Bacteria 100528
47 Ga0265324_10000989 3300029957 Bacteria 17483
48 Ga0265332_10016214 3300031238 Bacteria 3286
49 Ga0265328_10003146 3300031239 Bacteria 7347
50 Ga0265320_10000011 3300031240 Bacteria 249534
51 Ga0265325_10003387 3300031241 Bacteria 10438
52 Ga0265329_10008774 3300031242 Bacteria 3813
53 Ga0265331_10001052 3300031250 Bacteria 21500
54 Ga0265331_10243917 3300031250 Bacteria 806
55 Ga0265327_10000015 3300031251 Bacteria 496677
56 Ga0265314_10014622 3300031711 Bacteria 6266
57 Ga0265342_10109510 3300031712 Bacteria 1565
58 Ga0395905_0052653 3300037471 Bacteria 3811
59 Ga0395905_0089626 3300037471 Bacteria 2883
60 Ga0439437_008224 3300042000 Bacteria 1172
61 Ga0466969_0000233 3300044656 Bacteria 30390
62 Ga0466966_0000394 3300044684 Bacteria 28289
63 Ga0466961_0002305 3300044693 Bacteria 11861
64 Ga0466963_0062541 3300044694 Bacteria 2490
65 Ga0466971_0001686 3300044719 Bacteria 9355
66 Ga0466970_0023173 3300044765 Bacteria 3241
67 Ga0466957_0001431 3300044842 Bacteria 12459
68 Ga0466959_0000532 3300045049 Bacteria 22122
69 Ga0466958_0001234 3300045836 Bacteria 11989
70 Ga0495592_0071251 3300046454 Bacteria 2530
71 Ga0495603_0029656 3300046455 Bacteria 3297
72 Ga0495639_0074746 3300046475 Bacteria 1570
73 Ga0495662_0000061 3300046476 Bacteria 37295
74 Ga0495628_0001287 3300046516 Bacteria 22971
75 Ga0495628_0002849 3300046516 Bacteria 15497
76 Ga0495630_0001096 3300046517 Bacteria 18614
77 Ga0495652_0000010 3300046529 Bacteria 261584
78 Ga0495640_0019838 3300046533 Bacteria 4958
79 Ga0495640_0049149 3300046533 Bacteria 2910
80 Ga0495645_0614951 3300046543 Unclassified 667
81 Ga0495667_0623138 3300046559 Unclassified 671
82 Ga0495634_0000045 3300046642 Bacteria 99087
83 Ga0495634_0115795 3300046642 Bacteria 1720
84 Ga0495635_0000016 3300046663 Bacteria 214088
85 Ga0495635_0029598 3300046663 Bacteria 3809
86 Ga0495588_0389703 3300046674 Bacteria 731
87 Ga0495657_0006426 3300046675 Bacteria 9198
88 Ga0495647_0000004 3300046681 Bacteria 140700
89 Ga0495647_0056215 3300046681 Unclassified 1542
90 Ga0495647_0084035 3300046681 Bacteria 1295
91 Ga0495613_0000803 3300046689 Bacteria 24344
92 Ga0495600_0013749 3300046809 Bacteria 5096
93 Ga0495674_0000010 3300047319 Bacteria 285794
94 Ga0495680_0236593 3300047322 Bacteria 1298
95 Ga0495675_0224829 3300047444 Unclassified 1134
96 Ga0495686_0166252 3300047472 Bacteria 1286
97 Ga0495686_0350879 3300047472 Bacteria 802
98 Ga0495593_0090703 3300047673 Bacteria 1574
99 Ga0495602_0031782 3300048088 Bacteria 4984
100 Ga0496100_0000001 3300048903 Bacteria 530179
101 Ga0496101_0000004 3300048904 Bacteria 331599
102 Ga0496102_0262632 3300048905 Bacteria 1628
103 Ga0496103_0256080 3300048906 Bacteria 1126
104 Ga0496105_0009946 3300048908 Bacteria 7461
105 Ga0496106_0000056 3300048909 Bacteria 90682
106 Ga0496107_0000005 3300048910 Bacteria 281747
107 Ga0496109_1001216 3300048912 Bacteria 773
108 Ga0496114_0007464 3300048917 Bacteria 8645
109 Ga0496115_0006407 3300048918 Bacteria 8623
110 Ga0496115_0374601 3300048918 Unclassified 1158
111 Ga0496121_0047813 3300048924 Bacteria 3646
112 Ga0496121_0216591 3300048924 Bacteria 1352
113 Ga0496122_0339714 3300048925 Unclassified 789
114 Ga0496125_0318031 3300048928 Bacteria 945
115 Ga0496126_0024325 3300048929 Bacteria 5849
116 Ga0496126_0509635 3300048929 Bacteria 960
117 Ga0501034_0043132 3300049571 Bacteria 4566
118 Ga0501034_0061892 3300049571 Bacteria 3758
119 Ga0501070_0800042 3300049586 Bacteria 740
120 Ga0501074_0056924 3300049590 Bacteria 2817
121 Ga0501083_0025269 3300049744 Bacteria 4111
122 Ga0495612_0096748 3300053078 Bacteria 1254
123 Ga0500635_0006373 3300053080 Bacteria 3148
124 Ga0500644_0031390 3300053088 Bacteria 1689
125 Ga0500608_000351 3300053122 Bacteria 17772
126 Ga0500642_0220490 3300053130 Unclassified 878
127 Ga0466962_0001935 3300061719 Bacteria 9752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0350879 Ga0495686_0350879_55_582 151
2 3300005356 Ga0070674_100000016 Ga0070674_10000001642 160
3 3300006881 Ga0068865_101130338 Ga0068865_1011303381 160
4 3300046675 Ga0495657_0006426 Ga0495657_0006426_4155_4637 160
5 iso_pu_bacteria 2929297113 2929298873 160
6 3300005841 Ga0068863_100131783 Ga0068863_1001317832 161
7 3300005842 Ga0068858_100021740 Ga0068858_1000217402 161
8 3300013308 Ga0157375_10654522 Ga0157375_106545222 161
9 3300025931 Ga0207644_10605354 Ga0207644_106053542 161
10 3300026035 Ga0207703_10130871 Ga0207703_101308714 161
11 3300026088 Ga0207641_10217806 Ga0207641_102178062 161
12 3300046476 Ga0495662_0000061 Ga0495662_0000061_7131_7616 161
13 3300046516 Ga0495628_0002849 Ga0495628_0002849_12541_13026 161
14 3300046517 Ga0495630_0001096 Ga0495630_0001096_6221_6706 161
15 3300046533 Ga0495640_0019838 Ga0495640_0019838_3222_3707 161
16 3300046533 Ga0495640_0049149 Ga0495640_0049149_242_727 161
17 3300046642 Ga0495634_0115795 Ga0495634_0115795_995_1480 161
18 3300046663 Ga0495635_0000016 Ga0495635_0000016_162892_163377 161
19 3300047319 Ga0495674_0000010 Ga0495674_0000010_33544_34029 161
20 3300047444 Ga0495675_0224829 Ga0495675_0224829_500_985 161
21 3300047472 Ga0495686_0166252 Ga0495686_0166252_567_1052 161
22 3300048905 Ga0496102_0262632 Ga0496102_0262632_350_835 161
23 3300048906 Ga0496103_0256080 Ga0496103_0256080_33_518 161
24 3300005844 Ga0068862_100873093 Ga0068862_1008730931 162
25 3300046529 Ga0495652_0000010 Ga0495652_0000010_176371_176859 162
26 3300048912 Ga0496109_1001216 Ga0496109_1001216_58_546 162
27 3300013308 Ga0157375_10046837 Ga0157375_100468376 163
28 3300028556 Ga0265337_1000007 Ga0265337_100000756 163
29 3300028558 Ga0265326_10000019 Ga0265326_1000001954 163
30 3300028563 Ga0265319_1000014 Ga0265319_1000014146 163
31 3300028577 Ga0265318_10120260 Ga0265318_101202602 163
32 3300028654 Ga0265322_10000011 Ga0265322_1000001154 163
33 3300028654 Ga0265322_10065959 Ga0265322_100659592 163
34 3300028666 Ga0265336_10051434 Ga0265336_100514342 163
35 3300028800 Ga0265338_10000244 Ga0265338_1000024422 163
36 3300029957 Ga0265324_10000989 Ga0265324_1000098917 163
37 3300031238 Ga0265332_10016214 Ga0265332_100162142 163
38 3300031239 Ga0265328_10003146 Ga0265328_100031468 163
39 3300031240 Ga0265320_10000011 Ga0265320_1000001154 163
40 3300031241 Ga0265325_10003387 Ga0265325_1000338710 163
41 3300031242 Ga0265329_10008774 Ga0265329_100087744 163
42 3300031250 Ga0265331_10001052 Ga0265331_100010522 163
43 3300031250 Ga0265331_10243917 Ga0265331_102439172 163
44 3300031251 Ga0265327_10000015 Ga0265327_10000015162 163
45 3300031711 Ga0265314_10014622 Ga0265314_100146225 163
46 3300031712 Ga0265342_10109510 Ga0265342_101095102 163
47 3300046475 Ga0495639_0074746 Ga0495639_0074746_865_1356 163
48 3300046681 Ga0495647_0000004 Ga0495647_0000004_106919_107410 163
49 3300047673 Ga0495593_0090703 Ga0495593_0090703_728_1219 163
50 3300048918 Ga0496115_0374601 Ga0496115_0374601_336_827 163
51 3300005329 Ga0070683_100010698 Ga0070683_1000106981 164
52 3300005535 Ga0070684_100014270 Ga0070684_1000142706 164
53 3300025933 Ga0207706_10000026 Ga0207706_1000002669 164
54 3300025944 Ga0207661_10002763 Ga0207661_100027631 164
55 3300046559 Ga0495667_0623138 Ga0495667_0623138_11_505 164
56 3300046663 Ga0495635_0029598 Ga0495635_0029598_2556_3050 164
57 3300046809 Ga0495600_0013749 Ga0495600_0013749_497_991 164
58 3300048903 Ga0496100_0000001 Ga0496100_0000001_320989_321483 164
59 3300048904 Ga0496101_0000004 Ga0496101_0000004_122341_122835 164
60 3300048909 Ga0496106_0000056 Ga0496106_0000056_43314_43808 164
61 3300048910 Ga0496107_0000005 Ga0496107_0000005_208765_209259 164
62 3300053088 Ga0500644_0031390 Ga0500644_0031390_310_807 164
63 3300053130 Ga0500642_0220490 Ga0500642_0220490_259_756 164
64 3300005367 Ga0070667_100323504 Ga0070667_1003235042 165
65 3300005435 Ga0070714_100017531 Ga0070714_1000175316 165
66 3300005444 Ga0070694_100608804 Ga0070694_1006088041 165
67 3300005455 Ga0070663_100288220 Ga0070663_1002882202 165
68 3300005719 Ga0068861_100133694 Ga0068861_1001336942 165
69 3300009551 Ga0105238_10000011 Ga0105238_10000011142 165
70 3300025924 Ga0207694_10000004 Ga0207694_10000004481 165
71 3300025929 Ga0207664_10080689 Ga0207664_100806894 165
72 3300025986 Ga0207658_10263418 Ga0207658_102634182 165
73 3300026067 Ga0207678_10293879 Ga0207678_102938792 165
74 3300026118 Ga0207675_100180767 Ga0207675_1001807672 165
75 3300046516 Ga0495628_0001287 Ga0495628_0001287_14309_14809 165
76 3300046642 Ga0495634_0000045 Ga0495634_0000045_93171_93668 165
77 3300048088 Ga0495602_0031782 Ga0495602_0031782_2195_2704 165
78 3300048917 Ga0496114_0007464 Ga0496114_0007464_957_1463 165
79 3300048918 Ga0496115_0006407 Ga0496115_0006407_935_1441 165
80 3300049590 Ga0501074_0056924 Ga0501074_0056924_252_749 165
81 3300049744 Ga0501083_0025269 Ga0501083_0025269_2030_2527 165
82 3300053078 Ga0495612_0096748 Ga0495612_0096748_292_804 165
83 3300010375 Ga0105239_10092794 Ga0105239_100927943 166
84 3300046454 Ga0495592_0071251 Ga0495592_0071251_982_1488 167
85 3300047322 Ga0495680_0236593 Ga0495680_0236593_309_812 167
86 3300005335 Ga0070666_10018097 Ga0070666_100180974 168
87 3300025903 Ga0207680_10019823 Ga0207680_100198234 168
88 3300046455 Ga0495603_0029656 Ga0495603_0029656_2502_3026 168
89 3300046543 Ga0495645_0614951 Ga0495645_0614951_54_560 168
90 3300046674 Ga0495588_0389703 Ga0495588_0389703_18_542 168
91 3300046681 Ga0495647_0084035 Ga0495647_0084035_529_1053 168
92 3300048924 Ga0496121_0216591 Ga0496121_0216591_115_627 168
93 3300048929 Ga0496126_0024325 Ga0496126_0024325_283_798 168
94 3300049586 Ga0501070_0800042 Ga0501070_0800042_195_701 168
95 3300046681 Ga0495647_0056215 Ga0495647_0056215_802_1389 170
96 3300046689 Ga0495613_0000803 Ga0495613_0000803_19045_19641 170
97 3300048908 Ga0496105_0009946 Ga0496105_0009946_3600_4115 171
98 3300048924 Ga0496121_0047813 Ga0496121_0047813_2544_3059 171
99 3300048928 Ga0496125_0318031 Ga0496125_0318031_151_666 171
100 3300005367 Ga0070667_100197773 Ga0070667_1001977731 173
101 3300005548 Ga0070665_100056603 Ga0070665_1000566031 173
102 3300025903 Ga0207680_10164860 Ga0207680_101648602 173
103 3300025986 Ga0207658_10039233 Ga0207658_100392331 173
104 3300028379 Ga0268266_10000085 Ga0268266_10000085110 173
105 3300048929 Ga0496126_0509635 Ga0496126_0509635_291_818 173
106 3300053080 Ga0500635_0006373 Ga0500635_0006373_470_1081 174
107 3300013104 Ga0157370_10029972 Ga0157370_100299725 175
108 3300015684 Ga0183365_10004 Ga0183365_1000432 175
109 3300042000 Ga0439437_008224 Ga0439437_008224_28_567 175
110 3300048925 Ga0496122_0339714 Ga0496122_0339714_203_730 175
111 3300049571 Ga0501034_0043132 Ga0501034_0043132_1325_1852 175
112 3300049571 Ga0501034_0061892 Ga0501034_0061892_1537_2064 175
113 3300053122 Ga0500608_000351 Ga0500608_000351_668_1195 175
114 3300037471 Ga0395905_0089626 Ga0395905_0089626_2275_2814 178
115 3300003320 rootH2_10017250 rootH2_100172502 179
116 3300003323 rootH1_10112278 rootH1_101122782 179
117 3300009545 Ga0105237_11160517 Ga0105237_111605172 179
118 3300037471 Ga0395905_0052653 Ga0395905_0052653_2669_3208 179
119 3300044656 Ga0466969_0000233 Ga0466969_0000233_14484_15023 179
120 3300044684 Ga0466966_0000394 Ga0466966_0000394_17829_18368 179
121 3300044693 Ga0466961_0002305 Ga0466961_0002305_5748_6287 179
122 3300044694 Ga0466963_0062541 Ga0466963_0062541_833_1372 179
123 3300044719 Ga0466971_0001686 Ga0466971_0001686_5483_6022 179
124 3300044765 Ga0466970_0023173 Ga0466970_0023173_2058_2597 179
125 3300044842 Ga0466957_0001431 Ga0466957_0001431_3935_4474 179
126 3300045049 Ga0466959_0000532 Ga0466959_0000532_20382_20921 179
127 3300045836 Ga0466958_0001234 Ga0466958_0001234_3110_3649 179
128 3300061719 Ga0466962_0001935 Ga0466962_0001935_5356_5895 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

40

193

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.9772 14 178
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.9771 14 178
2c2p-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans 0.8967 14 178
2c2q-assembly1.cif.gz_A the crystal structure of mismatch specific uracil-dna glycosylase (mug) from deinococcus radiodurans. inactive mutant asp93ala. 0.8967 14 178
3uob-assembly1.cif.gz_B crystal structure of human thymine dna glycosylase bound to substrate analog 2'-deoxy-2'-beta-fluoro-cytidine 0.8894 16 178
ID Description Score Start End Superfamily
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.981 18 178 3.40.470.10
2c2qA01 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9242 18 178 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8849 16 179 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8835 16 179 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8807 4 177 3.40.470.10
ID Description Score Start End GO Terms
AF-V4NYX6-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9996 20 175 GO:0004844
GO:0006285
GO:0008263
AF-A0A2T5XH61-F1-model_v4 deleted 0.9957 1 176
AF-A0A7S8E727-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9944 16 177 GO:0004844
GO:0006285
GO:0008263
AF-A0A7X4CBZ0-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9933 16 177 GO:0004844
GO:0006285
GO:0008263
AF-A6GLD3-F1-model_v4 G/U mismatch-specific DNA glycosylase 0.993 16 174 GO:0004844
GO:0006285
GO:0008263

Feature Viewer

pLDDT pTM Quality
91.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map