F138947

General Info

Members Datasets Scaffolds Average Seq Length
128 83 118 329

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0016181|Ga0451577_0016181_5383_6486
Length 367
Sequence MKMKKIVDNSVDQKPLLRRGWGGLSSVNWGIIGCGNVTELKSGPAFNKVEHSRIVAVMRRNAALAEDYAKRHGVPKWYADADLLINDPEVNAVYIATPPNTHASYANQAMRAGKPVYVEKPMALNYKECQQMIKVSEETGMPLFVAYYRRTLPAFLKTKELIDNGVIGIPLTVHIKLHKATNEKDIPAEKHSWHVNPEIAGAGHFFDLASHQLDYLDFLFGPIIDVHGIAVNQAGYYKAEDTVTGTFRFGNGVVGTGSWCFVTDRSSFMDTIEITGTLGKIILPCFTHQDMELITAQGSVKFTVQNPENIQYHLIQQVVDELRGIGESPSTGKTAARTSAVLDEMVKNYYASRNDDNKRTKGSCRTI

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
3 2818991459 Paenibacillus sp. 597 Isolate Unclassified
4 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
5 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
6 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
7 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
8 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
9 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
75 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 0
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 0.78
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 10.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000940 3300002737 Bacteria 18700
2 JGI25164J39214_1000871 3300002772 Bacteria 10261
3 JGI25165J46597_1008563 3300003214 Bacteria 1594
4 rootH2_10184235 3300003320 Bacteria 2577
5 rootH1_10001262 3300003323 Bacteria 49298
6 Ga0055541_1001938 3300003841 Bacteria 4275
7 Ga0070683_100342212 3300005329 Unclassified 1424
8 Ga0070683_100366354 3300005329 Bacteria 1372
9 Ga0070670_100083195 3300005331 Unclassified 2750
10 Ga0070670_100137915 3300005331 Unclassified 2108
11 Ga0070670_100179344 3300005331 Unclassified 1839
12 Ga0070661_100049007 3300005344 Bacteria 3093
13 Ga0070675_100139964 3300005354 Bacteria 2068
14 Ga0070671_100167218 3300005355 Unclassified 1860
15 Ga0070671_100189961 3300005355 Bacteria 1741
16 Ga0070659_100003036 3300005366 Bacteria 11938
17 Ga0070663_100011066 3300005455 Bacteria 5648
18 Ga0070672_100145105 3300005543 Bacteria 1961
19 Ga0070693_100109234 3300005547 Bacteria 1698
20 Ga0068855_100000054 3300005563 Bacteria 139322
21 Ga0068855_100000498 3300005563 Bacteria 48519
22 Ga0068855_100228401 3300005563 Bacteria 2085
23 Ga0070664_100196406 3300005564 Unclassified 1799
24 Ga0068857_100130869 3300005577 Bacteria 2263
25 Ga0068852_100369753 3300005616 Bacteria 1404
26 Ga0068864_100301354 3300005618 Bacteria 1501
27 Ga0075434_100076963 3300006871 Bacteria 3331
28 Ga0105240_10201193 3300009093 Bacteria 2334
29 Ga0111539_10128271 3300009094 Bacteria 2971
30 Ga0105237_10005351 3300009545 Bacteria 14526
31 Ga0105237_10015314 3300009545 Bacteria 7986
32 Ga0105237_10095897 3300009545 Bacteria 2956
33 Ga0105238_10046751 3300009551 Bacteria 4365
34 Ga0105239_10000040 3300010375 Bacteria 201445
35 Ga0105239_10021827 3300010375 Bacteria 7057
36 Ga0157371_10001311 3300013102 Bacteria 26152
37 Ga0157370_10478493 3300013104 Unclassified 1144
38 Ga0157369_10001423 3300013105 Bacteria 29363
39 Ga0157374_10123828 3300013296 Unclassified 2497
40 Ga0157374_10327927 3300013296 Unclassified 1518
41 Ga0157372_10000026 3300013307 Bacteria 195407
42 Ga0157372_10042508 3300013307 Bacteria 5027
43 Ga0157372_10104496 3300013307 Bacteria 3238
44 Ga0209566_100046 3300025225 Bacteria 247053
45 Ga0207427_100137 3300025231 Bacteria 88182
46 Ga0209437_100112 3300025233 Bacteria 214292
47 Ga0209233_1000126 3300025261 Bacteria 214298
48 Ga0209455_1001550 3300025272 Bacteria 10182
49 Ga0207647_10000064 3300025904 Bacteria 82970
50 Ga0207695_10254085 3300025913 Bacteria 1656
51 Ga0207671_10001544 3300025914 Bacteria 26333
52 Ga0207649_10031372 3300025920 Bacteria 3157
53 Ga0207694_10026333 3300025924 Bacteria 4423
54 Ga0207650_10001267 3300025925 Bacteria 18332
55 Ga0207650_10115936 3300025925 Unclassified 2080
56 Ga0207644_10034197 3300025931 Bacteria 3556
57 Ga0207644_10163527 3300025931 Bacteria 1732
58 Ga0207667_10164292 3300025949 Bacteria 2283
59 Ga0207651_10152114 3300025960 Bacteria 1803
60 Ga0207678_10022411 3300026067 Bacteria 5531
61 Ga0207648_10224255 3300026089 Bacteria 1671
62 Ga0207698_10004227 3300026142 Bacteria 8733
63 Ga0207698_10105380 3300026142 Bacteria 2349
64 Ga0209984_1007528 3300027424 Bacteria 1353
65 Ga0265323_10042512 3300028653 Bacteria 1645
66 Ga0265338_10000319 3300028800 Bacteria 87159
67 Ga0265338_10066007 3300028800 Bacteria 3135
68 Ga0307408_100000708 3300031548 Bacteria 27156
69 Ga0316579_10084325 3300031691 Bacteria 1515
70 Ga0316576_10031674 3300031727 Bacteria 3754
71 Ga0316578_10007276 3300031728 Bacteria 5537
72 Ga0307410_10113716 3300031852 Bacteria 1963
73 Ga0307412_10198435 3300031911 Bacteria 1522
74 Ga0307414_10186813 3300032004 Bacteria 1673
75 Ga0307415_100107226 3300032126 Bacteria 2064
76 Ga0395899_0000055 3300037312 Bacteria 220579
77 Ga0400489_52777 3300039093 Bacteria 1402
78 Ga0451791_0845629 3300041451 Bacteria 3349
79 Ga0451833_1248186 3300041491 Bacteria 1398
80 Ga0451837_0084077 3300041494 Bacteria 2929
81 Ga0451841_1042815 3300041498 Bacteria 1439
82 Ga0451851_0054123 3300041507 Unclassified 1605
83 Ga0451577_0000123 3300042876 Bacteria 169380
84 Ga0451577_0000197 3300042876 Bacteria 126180
85 Ga0451577_0001472 3300042876 Bacteria 31282
86 Ga0451577_0016181 3300042876 Bacteria 6914
87 Ga0451577_0045719 3300042876 Bacteria 3919
88 Ga0451577_0180280 3300042876 Bacteria 1904
89 Ga0466969_0017892 3300044656 Bacteria 3697
90 Ga0453683_0000005 3300044673 Bacteria 741657
91 Ga0453683_0000169 3300044673 Bacteria 90993
92 Ga0453683_0006794 3300044673 Bacteria 7815
93 Ga0453683_0007284 3300044673 Bacteria 7535
94 Ga0453683_0011824 3300044673 Bacteria 5744
95 Ga0453683_0038592 3300044673 Bacteria 3002
96 Ga0453683_0098040 3300044673 Unclassified 1840
97 Ga0453683_0296738 3300044673 Bacteria 1033
98 Ga0453684_0000127 3300044712 Bacteria 336026
99 Ga0453684_0000393 3300044712 Bacteria 179711
100 Ga0453684_0001454 3300044712 Bacteria 67293
101 Ga0453684_0012346 3300044712 Bacteria 14119
102 Ga0453684_0014058 3300044712 Bacteria 12878
103 Ga0453684_0021256 3300044712 Bacteria 9710
104 Ga0453684_0035684 3300044712 Bacteria 6869
105 Ga0453684_0037995 3300044712 Bacteria 6595
106 Ga0453684_0190002 3300044712 Bacteria 2403
107 Ga0453684_0205341 3300044712 Unclassified 2294
108 Ga0466959_0028485 3300045049 Bacteria 4142
109 Ga0451576_0000145 3300045051 Bacteria 179711
110 Ga0451576_0000178 3300045051 Bacteria 160411
111 Ga0451576_0000613 3300045051 Bacteria 74967
112 Ga0451576_0018045 3300045051 Bacteria 7743
113 Ga0451576_0032384 3300045051 Bacteria 5567
114 Ga0451576_0271385 3300045051 Unclassified 1773
115 Ga0451576_0405426 3300045051 Bacteria 1430
116 Ga0495686_0029106 3300047472 Bacteria 3595
117 Ga0495686_0044547 3300047472 Bacteria 2809
118 Ga0495686_0076784 3300047472 Bacteria 2046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027424 Ga0209984_1007528 Ga0209984_10075282 272
2 3300044673 Ga0453683_0296738 Ga0453683_0296738_62_934 288
3 3300042876 Ga0451577_0180280 Ga0451577_0180280_936_1868 290
4 3300003841 Ga0055541_1001938 Ga0055541_10019381 297
5 3300025225 Ga0209566_100046 Ga0209566_100046137 297
6 3300003320 rootH2_10184235 rootH2_101842353 299
7 iso_pu_bacteria 2852646457 2852648129 312
8 3300031691 Ga0316579_10084325 Ga0316579_100843251 316
9 3300031728 Ga0316578_10007276 Ga0316578_100072764 316
10 3300039093 Ga0400489_52777 Ga0400489_52777_292_1263 316
11 iso_pu_bacteria 2585428059 2587742279 316
12 iso_pu_bacteria 2643221676 2644425601 316
13 iso_pu_bacteria 2818991459 2819674231 316
14 iso_pu_bacteria 2857453340 2857457659 316
15 iso_pu_bacteria 2904755435 2904762564 316
16 iso_pu_bacteria 2919425241 2919430485 316
17 iso_pu_bacteria 2971410472 2971410665 316
18 iso_pu_bacteria 2980182181 2980188367 316
19 iso_pu_bacteria 8056533031 8056534986 316
20 3300009094 Ga0111539_10128271 Ga0111539_101282711 318
21 3300031852 Ga0307410_10113716 Ga0307410_101137162 318
22 3300032004 Ga0307414_10186813 Ga0307414_101868132 318
23 3300032126 Ga0307415_100107226 Ga0307415_1001072262 318
24 3300028653 Ga0265323_10042512 Ga0265323_100425122 320
25 3300031548 Ga0307408_100000708 Ga0307408_10000070817 322
26 3300041451 Ga0451791_0845629 Ga0451791_0845629_1888_2886 322
27 3300041491 Ga0451833_1248186 Ga0451833_1248186_331_1329 322
28 3300041494 Ga0451837_0084077 Ga0451837_0084077_1285_2283 322
29 3300041498 Ga0451841_1042815 Ga0451841_1042815_135_1133 322
30 3300044712 Ga0453684_0035684 Ga0453684_0035684_718_1692 322
31 3300045051 Ga0451576_0405426 Ga0451576_0405426_154_1128 322
32 3300028800 Ga0265338_10000319 Ga0265338_1000031936 323
33 3300045049 Ga0466959_0028485 Ga0466959_0028485_1680_2663 323
34 3300005329 Ga0070683_100366354 Ga0070683_1003663542 324
35 3300005331 Ga0070670_100083195 Ga0070670_1000831953 324
36 3300005331 Ga0070670_100137915 Ga0070670_1001379152 324
37 3300005331 Ga0070670_100179344 Ga0070670_1001793442 324
38 3300005344 Ga0070661_100049007 Ga0070661_1000490073 324
39 3300005354 Ga0070675_100139964 Ga0070675_1001399643 324
40 3300005355 Ga0070671_100167218 Ga0070671_1001672182 324
41 3300005355 Ga0070671_100189961 Ga0070671_1001899612 324
42 3300005366 Ga0070659_100003036 Ga0070659_1000030367 324
43 3300005455 Ga0070663_100011066 Ga0070663_1000110663 324
44 3300005543 Ga0070672_100145105 Ga0070672_1001451051 324
45 3300005547 Ga0070693_100109234 Ga0070693_1001092341 324
46 3300005563 Ga0068855_100228401 Ga0068855_1002284012 324
47 3300005564 Ga0070664_100196406 Ga0070664_1001964063 324
48 3300005577 Ga0068857_100130869 Ga0068857_1001308693 324
49 3300005616 Ga0068852_100369753 Ga0068852_1003697532 324
50 3300005618 Ga0068864_100301354 Ga0068864_1003013542 324
51 3300006871 Ga0075434_100076963 Ga0075434_1000769633 324
52 3300009545 Ga0105237_10015314 Ga0105237_100153143 324
53 3300009545 Ga0105237_10095897 Ga0105237_100958972 324
54 3300010375 Ga0105239_10021827 Ga0105239_100218276 324
55 3300013102 Ga0157371_10001311 Ga0157371_100013116 324
56 3300013105 Ga0157369_10001423 Ga0157369_1000142318 324
57 3300013296 Ga0157374_10123828 Ga0157374_101238283 324
58 3300013296 Ga0157374_10327927 Ga0157374_103279272 324
59 3300013307 Ga0157372_10000026 Ga0157372_1000002648 324
60 3300013307 Ga0157372_10042508 Ga0157372_100425083 324
61 3300013307 Ga0157372_10104496 Ga0157372_101044964 324
62 3300025904 Ga0207647_10000064 Ga0207647_1000006438 324
63 3300025920 Ga0207649_10031372 Ga0207649_100313723 324
64 3300025925 Ga0207650_10001267 Ga0207650_1000126710 324
65 3300025925 Ga0207650_10115936 Ga0207650_101159362 324
66 3300025931 Ga0207644_10034197 Ga0207644_100341973 324
67 3300025931 Ga0207644_10163527 Ga0207644_101635273 324
68 3300025949 Ga0207667_10164292 Ga0207667_101642922 324
69 3300025960 Ga0207651_10152114 Ga0207651_101521142 324
70 3300026067 Ga0207678_10022411 Ga0207678_100224116 324
71 3300026089 Ga0207648_10224255 Ga0207648_102242552 324
72 3300026142 Ga0207698_10004227 Ga0207698_100042273 324
73 3300026142 Ga0207698_10105380 Ga0207698_101053802 324
74 3300031911 Ga0307412_10198435 Ga0307412_101984352 324
75 3300037312 Ga0395899_0000055 Ga0395899_0000055_184364_185347 324
76 3300042876 Ga0451577_0000123 Ga0451577_0000123_24431_25426 324
77 3300042876 Ga0451577_0045719 Ga0451577_0045719_2565_3560 324
78 3300044656 Ga0466969_0017892 Ga0466969_0017892_374_1354 324
79 3300044673 Ga0453683_0011824 Ga0453683_0011824_1664_2659 324
80 3300044673 Ga0453683_0038592 Ga0453683_0038592_1959_2951 324
81 3300044673 Ga0453683_0098040 Ga0453683_0098040_183_1178 324
82 3300044712 Ga0453684_0000127 Ga0453684_0000127_310601_311596 324
83 3300044712 Ga0453684_0012346 Ga0453684_0012346_11596_12600 324
84 3300044712 Ga0453684_0037995 Ga0453684_0037995_5004_5990 324
85 3300044712 Ga0453684_0205341 Ga0453684_0205341_1271_2266 324
86 3300045051 Ga0451576_0000178 Ga0451576_0000178_134986_135981 324
87 3300045051 Ga0451576_0271385 Ga0451576_0271385_618_1613 324
88 3300047472 Ga0495686_0029106 Ga0495686_0029106_2306_3286 324
89 3300047472 Ga0495686_0044547 Ga0495686_0044547_851_1831 324
90 3300047472 Ga0495686_0076784 Ga0495686_0076784_525_1514 324
91 3300003323 rootH1_10001262 rootH1_1000126238 325
92 3300005563 Ga0068855_100000054 Ga0068855_10000005483 325
93 3300005563 Ga0068855_100000498 Ga0068855_10000049839 325
94 3300009093 Ga0105240_10201193 Ga0105240_102011932 325
95 3300009545 Ga0105237_10005351 Ga0105237_1000535115 325
96 3300009551 Ga0105238_10046751 Ga0105238_100467513 325
97 3300010375 Ga0105239_10000040 Ga0105239_1000004031 325
98 3300025272 Ga0209455_1001550 Ga0209455_10015503 325
99 3300025913 Ga0207695_10254085 Ga0207695_102540852 325
100 3300025914 Ga0207671_10001544 Ga0207671_1000154411 325
101 3300025924 Ga0207694_10026333 Ga0207694_100263333 325
102 3300028800 Ga0265338_10066007 Ga0265338_100660073 325
103 3300044673 Ga0453683_0006794 Ga0453683_0006794_2796_3836 326
104 3300044673 Ga0453683_0007284 Ga0453683_0007284_3074_4114 326
105 3300031727 Ga0316576_10031674 Ga0316576_100316742 327
106 3300042876 Ga0451577_0000197 Ga0451577_0000197_88428_89432 327
107 3300044673 Ga0453683_0000005 Ga0453683_0000005_228331_229374 327
108 3300044673 Ga0453683_0000169 Ga0453683_0000169_74519_75523 327
109 3300044712 Ga0453684_0000393 Ga0453684_0000393_36749_37753 327
110 3300045051 Ga0451576_0000145 Ga0451576_0000145_36749_37753 327
111 3300045051 Ga0451576_0018045 Ga0451576_0018045_97_1137 327
112 3300041507 Ga0451851_0054123 Ga0451851_0054123_278_1279 328
113 3300042876 Ga0451577_0001472 Ga0451577_0001472_28246_29334 331
114 3300044712 Ga0453684_0001454 Ga0453684_0001454_3269_4357 331
115 3300045051 Ga0451576_0000613 Ga0451576_0000613_3269_4357 331
116 3300013104 Ga0157370_10478493 Ga0157370_104784931 332
117 3300005329 Ga0070683_100342212 Ga0070683_1003422121 333
118 3300042876 Ga0451577_0016181 Ga0451577_0016181_5383_6486 334
119 3300044712 Ga0453684_0014058 Ga0453684_0014058_6452_7507 334
120 3300044712 Ga0453684_0021256 Ga0453684_0021256_8106_9203 334
121 3300044712 Ga0453684_0190002 Ga0453684_0190002_15_1118 334
122 3300045051 Ga0451576_0032384 Ga0451576_0032384_4024_5127 334
123 3300002737 JGI25162J39368_1000940 JGI25162J39368_100094016 335
124 3300002772 JGI25164J39214_1000871 JGI25164J39214_10008716 335
125 3300003214 JGI25165J46597_1008563 JGI25165J46597_10085631 335
126 3300025231 Ga0207427_100137 Ga0207427_10013758 335
127 3300025233 Ga0209437_100112 Ga0209437_100112116 335
128 3300025261 Ga0209233_1000126 Ga0209233_100012665 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

155

282

0.97

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

27

147

0.95

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

159

351

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zh8-assembly1.cif.gz_B crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution 0.9128 12 334
6a3g-assembly1.cif.gz_D levoglucosan dehydrogenase, complex with nadh 0.8926 14 332
3e9m-assembly2.cif.gz_C-2 crystal structure of an oxidoreductase from enterococcus faecalis 0.8881 12 332
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.8873 12 332
3evn-assembly1.cif.gz_A crystal structure of putative oxidoreductase from streptococcus agalactiae 2603v/r 0.8867 14 332
ID Description Score Start End Superfamily
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 14 132 3.40.50.720
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9422 13 133 3.40.50.720
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 14 121 3.40.50.720
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9383 14 131 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9285 12 133 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0P7YWM2-F1-model_v4 Putative dehydrogenase 0.9818 11 111 GO:0000166
AF-A0A6L7WAF6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.974 11 332 GO:0000166
GO:0016491
AF-A0A2E8HMQ9-F1-model_v4 Oxidoreductase 0.9707 11 335 GO:0000166
GO:0016491
AF-A0A7G5DXT4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9687 12 333 GO:0000166
GO:0016491
AF-A0A2V9TAZ6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9677 14 117 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.64 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map