F138589

General Info

Members Datasets Scaffolds Average Seq Length
128 22 128 132

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10534642|Ga0316578_105346422
Length 139
Sequence LSDNHMHMGKINSLDDLRILSKSLDTKIQARNKDHKDLIRIKVAMATCSIASGSRDTINYLRDELEKRNIEAEVTQTGCMGYCYAEPTIEVILPGREPLVFGYVDEKKADEIIEKYIRHGELVEGIIPVNYQDLEDTSN

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
3 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
4 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
5 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
6 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
7 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
8 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
9 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
10 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
11 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
12 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
13 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
14 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
15 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
16 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
17 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
18 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
19 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
20 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
21 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
22 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10185118 3300028558 Bacteria 597
2 Ga0265323_10000268 3300028653 Bacteria 30560
3 Ga0265323_10107650 3300028653 Unclassified 917
4 Ga0265323_10178422 3300028653 Bacteria 673
5 Ga0265336_10021681 3300028666 Bacteria 2052
6 Ga0265338_10111117 3300028800 Bacteria 2207
7 Ga0265338_10866846 3300028800 Bacteria 616
8 Ga0265330_10455692 3300031235 Unclassified 543
9 Ga0265320_10191112 3300031240 Bacteria 915
10 Ga0265316_10000407 3300031344 Bacteria 49199
11 Ga0265316_10000980 3300031344 Bacteria 30988
12 Ga0265316_10025108 3300031344 Bacteria 4977
13 Ga0265316_10277959 3300031344 Bacteria 1224
14 Ga0265316_10649908 3300031344 Bacteria 746
15 Ga0316579_10283389 3300031691 Bacteria 801
16 Ga0265342_10078979 3300031712 Bacteria 1904
17 Ga0265342_10156729 3300031712 Unclassified 1261
18 Ga0316576_10057068 3300031727 Bacteria 2853
19 Ga0316576_10130117 3300031727 Bacteria 1893
20 Ga0316576_10139847 3300031727 Bacteria 1823
21 Ga0316576_10200273 3300031727 Unclassified 1504
22 Ga0316578_10001801 3300031728 Bacteria 9003
23 Ga0316578_10221184 3300031728 Bacteria 1138
24 Ga0316578_10534642 3300031728 Bacteria 689
25 Ga0316577_10006245 3300031733 Bacteria 6288
26 Ga0316585_10026635 3300032137 Bacteria 1800
27 Ga0316574_0237113 3300035398 Bacteria 1167
28 Ga0316582_0061586 3300036647 Bacteria 2407
29 Ga0316584_0000485 3300036712 Bacteria 20941
30 Ga0316584_0017725 3300036712 Bacteria 5128
31 Ga0316584_0367947 3300036712 Unclassified 1029
32 Ga0400483_103617 3300039062 Bacteria 6601
33 Ga0400483_119190 3300039062 Bacteria 4315
34 Ga0400483_166689 3300039062 Bacteria 37380
35 Ga0400483_255483 3300039062 Bacteria 1263
36 Ga0451855_0248578 3300041511 Bacteria 4200
37 Ga0451855_0490501 3300041511 Bacteria 1423
38 Ga0451855_0842564 3300041511 Unclassified 2921
39 Ga0451855_1565457 3300041511 Bacteria 823
40 Ga0451855_1830635 3300041511 Unclassified 1152
41 Ga0451577_0000140 3300042876 Bacteria 161646
42 Ga0451577_0000173 3300042876 Bacteria 142333
43 Ga0451577_0005748 3300042876 Bacteria 12577
44 Ga0451577_0007906 3300042876 Bacteria 10391
45 Ga0451577_0036974 3300042876 Bacteria 4396
46 Ga0451577_0038239 3300042876 Bacteria 4317
47 Ga0451577_0048302 3300042876 Bacteria 3802
48 Ga0451577_0059456 3300042876 Bacteria 3407
49 Ga0451577_0070223 3300042876 Bacteria 3124
50 Ga0451577_0070653 3300042876 Bacteria 3113
51 Ga0451577_0078900 3300042876 Bacteria 2935
52 Ga0451577_0141997 3300042876 Bacteria 2158
53 Ga0451577_0152114 3300042876 Bacteria 2082
54 Ga0451577_0171125 3300042876 Bacteria 1957
55 Ga0451577_0179232 3300042876 Unclassified 1910
56 Ga0451577_0226826 3300042876 Bacteria 1689
57 Ga0451577_0290290 3300042876 Bacteria 1482
58 Ga0451577_0396523 3300042876 Unclassified 1252
59 Ga0451577_0500687 3300042876 Bacteria 1103
60 Ga0451577_0549638 3300042876 Bacteria 1048
61 Ga0451577_0897907 3300042876 Unclassified 798
62 Ga0453683_0000045 3300044673 Bacteria 211088
63 Ga0453683_0000065 3300044673 Bacteria 166630
64 Ga0453683_0000263 3300044673 Bacteria 68710
65 Ga0453683_0000564 3300044673 Bacteria 40953
66 Ga0453683_0001533 3300044673 Bacteria 19678
67 Ga0453683_0015555 3300044673 Bacteria 4924
68 Ga0453683_0052118 3300044673 Bacteria 2562
69 Ga0453683_0106172 3300044673 Unclassified 1765
70 Ga0453683_0244044 3300044673 Bacteria 1144
71 Ga0453683_0254738 3300044673 Unclassified 1119
72 Ga0453683_0336614 3300044673 Bacteria 968
73 Ga0453683_0359304 3300044673 Bacteria 936
74 Ga0453683_0419569 3300044673 Bacteria 863
75 Ga0453683_0974058 3300044673 Bacteria 562
76 Ga0453683_1124267 3300044673 Bacteria 524
77 Ga0453684_0000051 3300044712 Bacteria 551033
78 Ga0453684_0000084 3300044712 Bacteria 398306
79 Ga0453684_0000139 3300044712 Bacteria 320330
80 Ga0453684_0000226 3300044712 Bacteria 244912
81 Ga0453684_0000542 3300044712 Bacteria 143132
82 Ga0453684_0000846 3300044712 Bacteria 103225
83 Ga0453684_0012479 3300044712 Bacteria 13999
84 Ga0453684_0013410 3300044712 Bacteria 13312
85 Ga0453684_0014002 3300044712 Bacteria 12916
86 Ga0453684_0036515 3300044712 Bacteria 6771
87 Ga0453684_0043562 3300044712 Bacteria 6029
88 Ga0453684_0059727 3300044712 Bacteria 4913
89 Ga0453684_0059984 3300044712 Bacteria 4899
90 Ga0453684_0061422 3300044712 Bacteria 4824
91 Ga0453684_0066947 3300044712 Bacteria 4571
92 Ga0453684_0068197 3300044712 Bacteria 4518
93 Ga0453684_0075185 3300044712 Bacteria 4248
94 Ga0453684_0075829 3300044712 Bacteria 4224
95 Ga0453684_0120891 3300044712 Bacteria 3162
96 Ga0453684_0125072 3300044712 Bacteria 3096
97 Ga0453684_0127437 3300044712 Bacteria 3061
98 Ga0453684_0138394 3300044712 Bacteria 2912
99 Ga0453684_0163991 3300044712 Bacteria 2625
100 Ga0453684_0198306 3300044712 Bacteria 2342
101 Ga0453684_0246804 3300044712 Bacteria 2052
102 Ga0453684_0398983 3300044712 Bacteria 1541
103 Ga0453684_0634236 3300044712 Bacteria 1168
104 Ga0453684_0822169 3300044712 Bacteria 1000
105 Ga0453684_1079647 3300044712 Bacteria 849
106 Ga0453684_1449846 3300044712 Bacteria 710
107 Ga0453684_2253019 3300044712 Bacteria 543
108 Ga0451576_0000135 3300045051 Bacteria 186763
109 Ga0451576_0000175 3300045051 Bacteria 161976
110 Ga0451576_0000176 3300045051 Bacteria 161951
111 Ga0451576_0000216 3300045051 Bacteria 142333
112 Ga0451576_0000884 3300045051 Bacteria 56978
113 Ga0451576_0001593 3300045051 Bacteria 38143
114 Ga0451576_0003386 3300045051 Bacteria 22032
115 Ga0451576_0011308 3300045051 Bacteria 10155
116 Ga0451576_0023707 3300045051 Bacteria 6640
117 Ga0451576_0030635 3300045051 Bacteria 5747
118 Ga0451576_0064038 3300045051 Bacteria 3831
119 Ga0451576_0065619 3300045051 Bacteria 3779
120 Ga0451576_0150867 3300045051 Unclassified 2424
121 Ga0451576_0298600 3300045051 Bacteria 1684
122 Ga0451576_0438013 3300045051 Bacteria 1372
123 Ga0451576_0440779 3300045051 Bacteria 1367
124 Ga0451576_0444263 3300045051 Bacteria 1361
125 Ga0451576_0692901 3300045051 Bacteria 1070
126 Ga0451576_1222985 3300045051 Bacteria 784
127 Ga0451576_1299482 3300045051 Bacteria 758
128 Ga0451576_1607225 3300045051 Bacteria 674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0897907 Ga0451577_0897907_381_770 110
2 3300042876 Ga0451577_0005748 Ga0451577_0005748_10254_10637 127
3 3300042876 Ga0451577_0078900 Ga0451577_0078900_794_1231 127
4 3300044673 Ga0453683_0244044 Ga0453683_0244044_668_1051 127
5 3300045051 Ga0451576_1299482 Ga0451576_1299482_197_634 127
6 3300041511 Ga0451855_0248578 Ga0451855_0248578_3469_3858 129
7 3300041511 Ga0451855_0490501 Ga0451855_0490501_692_1081 129
8 3300041511 Ga0451855_0842564 Ga0451855_0842564_285_674 129
9 3300028653 Ga0265323_10000268 Ga0265323_100002685 130
10 3300031344 Ga0265316_10000407 Ga0265316_1000040731 130
11 3300031712 Ga0265342_10156729 Ga0265342_101567292 130
12 3300031727 Ga0316576_10130117 Ga0316576_101301171 130
13 3300031728 Ga0316578_10221184 Ga0316578_102211842 130
14 3300036647 Ga0316582_0061586 Ga0316582_0061586_40_432 130
15 3300036712 Ga0316584_0367947 Ga0316584_0367947_48_440 130
16 3300039062 Ga0400483_255483 Ga0400483_255483_710_1102 130
17 3300042876 Ga0451577_0500687 Ga0451577_0500687_225_617 130
18 3300044673 Ga0453683_1124267 Ga0453683_1124267_122_514 130
19 3300044712 Ga0453684_0012479 Ga0453684_0012479_63_455 130
20 3300044712 Ga0453684_0125072 Ga0453684_0125072_1738_2130 130
21 3300045051 Ga0451576_0001593 Ga0451576_0001593_34188_34580 130
22 3300045051 Ga0451576_0023707 Ga0451576_0023707_444_836 130
23 3300028800 Ga0265338_10866846 Ga0265338_108668461 131
24 3300031344 Ga0265316_10649908 Ga0265316_106499082 131
25 3300031727 Ga0316576_10057068 Ga0316576_100570682 131
26 3300031727 Ga0316576_10139847 Ga0316576_101398472 131
27 3300031728 Ga0316578_10534642 Ga0316578_105346422 131
28 3300031733 Ga0316577_10006245 Ga0316577_100062454 131
29 3300036712 Ga0316584_0000485 Ga0316584_0000485_15151_15549 131
30 3300041511 Ga0451855_1565457 Ga0451855_1565457_248_643 131
31 3300041511 Ga0451855_1830635 Ga0451855_1830635_720_1115 131
32 3300042876 Ga0451577_0000140 Ga0451577_0000140_113894_114289 131
33 3300042876 Ga0451577_0007906 Ga0451577_0007906_8280_8675 131
34 3300042876 Ga0451577_0036974 Ga0451577_0036974_625_1020 131
35 3300042876 Ga0451577_0048302 Ga0451577_0048302_3028_3423 131
36 3300042876 Ga0451577_0070653 Ga0451577_0070653_1839_2234 131
37 3300042876 Ga0451577_0141997 Ga0451577_0141997_317_712 131
38 3300042876 Ga0451577_0290290 Ga0451577_0290290_560_955 131
39 3300042876 Ga0451577_0396523 Ga0451577_0396523_178_573 131
40 3300042876 Ga0451577_0549638 Ga0451577_0549638_387_782 131
41 3300044673 Ga0453683_0000564 Ga0453683_0000564_28194_28589 131
42 3300044673 Ga0453683_0001533 Ga0453683_0001533_4266_4661 131
43 3300044712 Ga0453684_0000051 Ga0453684_0000051_248804_249199 131
44 3300044712 Ga0453684_0000084 Ga0453684_0000084_88023_88418 131
45 3300044712 Ga0453684_0000226 Ga0453684_0000226_172321_172716 131
46 3300044712 Ga0453684_0000846 Ga0453684_0000846_9702_10097 131
47 3300044712 Ga0453684_0013410 Ga0453684_0013410_12147_12542 131
48 3300044712 Ga0453684_0036515 Ga0453684_0036515_5852_6247 131
49 3300044712 Ga0453684_0068197 Ga0453684_0068197_3872_4267 131
50 3300044712 Ga0453684_0127437 Ga0453684_0127437_2050_2445 131
51 3300044712 Ga0453684_0138394 Ga0453684_0138394_510_905 131
52 3300044712 Ga0453684_0198306 Ga0453684_0198306_857_1252 131
53 3300044712 Ga0453684_0246804 Ga0453684_0246804_348_743 131
54 3300044712 Ga0453684_1079647 Ga0453684_1079647_331_726 131
55 3300045051 Ga0451576_0000175 Ga0451576_0000175_68453_68848 131
56 3300045051 Ga0451576_0000176 Ga0451576_0000176_87513_87908 131
57 3300045051 Ga0451576_0030635 Ga0451576_0030635_3280_3675 131
58 3300045051 Ga0451576_0064038 Ga0451576_0064038_768_1163 131
59 3300045051 Ga0451576_0065619 Ga0451576_0065619_2698_3093 131
60 3300045051 Ga0451576_0444263 Ga0451576_0444263_653_1048 131
61 3300028653 Ga0265323_10107650 Ga0265323_101076501 132
62 3300031235 Ga0265330_10455692 Ga0265330_104556921 132
63 3300031344 Ga0265316_10025108 Ga0265316_100251085 132
64 3300042876 Ga0451577_0000173 Ga0451577_0000173_74303_74701 132
65 3300042876 Ga0451577_0152114 Ga0451577_0152114_1623_2021 132
66 3300042876 Ga0451577_0179232 Ga0451577_0179232_911_1309 132
67 3300044673 Ga0453683_0000045 Ga0453683_0000045_145634_146032 132
68 3300044673 Ga0453683_0000263 Ga0453683_0000263_43446_43844 132
69 3300044673 Ga0453683_0974058 Ga0453683_0974058_150_548 132
70 3300044712 Ga0453684_0000542 Ga0453684_0000542_75102_75500 132
71 3300044712 Ga0453684_0059727 Ga0453684_0059727_2800_3198 132
72 3300044712 Ga0453684_0059984 Ga0453684_0059984_1030_1428 132
73 3300044712 Ga0453684_0075829 Ga0453684_0075829_232_630 132
74 3300044712 Ga0453684_0163991 Ga0453684_0163991_1563_1961 132
75 3300044712 Ga0453684_0398983 Ga0453684_0398983_14_412 132
76 3300044712 Ga0453684_1449846 Ga0453684_1449846_251_649 132
77 3300045051 Ga0451576_0000216 Ga0451576_0000216_74303_74701 132
78 3300045051 Ga0451576_0003386 Ga0451576_0003386_14250_14648 132
79 3300045051 Ga0451576_0011308 Ga0451576_0011308_1208_1606 132
80 3300045051 Ga0451576_0298600 Ga0451576_0298600_783_1181 132
81 3300045051 Ga0451576_0438013 Ga0451576_0438013_348_746 132
82 3300045051 Ga0451576_0692901 Ga0451576_0692901_11_409 132
83 3300045051 Ga0451576_1607225 Ga0451576_1607225_94_492 132
84 3300028558 Ga0265326_10185118 Ga0265326_101851181 133
85 3300028653 Ga0265323_10178422 Ga0265323_101784221 133
86 3300028666 Ga0265336_10021681 Ga0265336_100216814 133
87 3300028800 Ga0265338_10111117 Ga0265338_101111172 133
88 3300031240 Ga0265320_10191112 Ga0265320_101911122 133
89 3300031344 Ga0265316_10000980 Ga0265316_1000098015 133
90 3300031344 Ga0265316_10277959 Ga0265316_102779592 133
91 3300031691 Ga0316579_10283389 Ga0316579_102833892 133
92 3300031712 Ga0265342_10078979 Ga0265342_100789792 133
93 3300031727 Ga0316576_10200273 Ga0316576_102002732 133
94 3300031728 Ga0316578_10001801 Ga0316578_100018012 133
95 3300032137 Ga0316585_10026635 Ga0316585_100266352 133
96 3300035398 Ga0316574_0237113 Ga0316574_0237113_722_1135 133
97 3300036712 Ga0316584_0017725 Ga0316584_0017725_2781_3194 133
98 3300039062 Ga0400483_103617 Ga0400483_103617_3261_3662 133
99 3300039062 Ga0400483_119190 Ga0400483_119190_2584_2985 133
100 3300039062 Ga0400483_166689 Ga0400483_166689_1100_1501 133
101 3300042876 Ga0451577_0038239 Ga0451577_0038239_684_1094 133
102 3300042876 Ga0451577_0059456 Ga0451577_0059456_2171_2572 133
103 3300042876 Ga0451577_0070223 Ga0451577_0070223_1757_2173 133
104 3300042876 Ga0451577_0171125 Ga0451577_0171125_908_1309 133
105 3300042876 Ga0451577_0226826 Ga0451577_0226826_88_489 133
106 3300044673 Ga0453683_0000065 Ga0453683_0000065_22381_22782 133
107 3300044673 Ga0453683_0015555 Ga0453683_0015555_1855_2256 133
108 3300044673 Ga0453683_0052118 Ga0453683_0052118_661_1062 133
109 3300044673 Ga0453683_0106172 Ga0453683_0106172_1279_1689 133
110 3300044673 Ga0453683_0254738 Ga0453683_0254738_576_986 133
111 3300044673 Ga0453683_0336614 Ga0453683_0336614_469_885 133
112 3300044673 Ga0453683_0359304 Ga0453683_0359304_117_518 133
113 3300044673 Ga0453683_0419569 Ga0453683_0419569_50_451 133
114 3300044712 Ga0453684_0000139 Ga0453684_0000139_69549_69950 133
115 3300044712 Ga0453684_0014002 Ga0453684_0014002_10679_11095 133
116 3300044712 Ga0453684_0043562 Ga0453684_0043562_4650_5051 133
117 3300044712 Ga0453684_0061422 Ga0453684_0061422_2793_3194 133
118 3300044712 Ga0453684_0066947 Ga0453684_0066947_1002_1403 133
119 3300044712 Ga0453684_0075185 Ga0453684_0075185_1607_2008 133
120 3300044712 Ga0453684_0120891 Ga0453684_0120891_1857_2315 133
121 3300044712 Ga0453684_0634236 Ga0453684_0634236_549_950 133
122 3300044712 Ga0453684_0822169 Ga0453684_0822169_357_758 133
123 3300044712 Ga0453684_2253019 Ga0453684_2253019_56_457 133
124 3300045051 Ga0451576_0000135 Ga0451576_0000135_113990_114391 133
125 3300045051 Ga0451576_0000884 Ga0451576_0000884_28003_28404 133
126 3300045051 Ga0451576_0150867 Ga0451576_0150867_20_421 133
127 3300045051 Ga0451576_0440779 Ga0451576_0440779_547_948 133
128 3300045051 Ga0451576_1222985 Ga0451576_1222985_340_741 133

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oh5-assembly1.cif.gz_B cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8933 35 122
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8568 32 128
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.8357 30 124
6tg9-assembly1.cif.gz_B cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.8316 35 125
7ard-assembly1.cif.gz_E cryo-em structure of polytomella complex-i (complete composition) 0.8293 32 120
ID Description Score Start End Superfamily
af_Q9C5W0_258_354_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.913 34 108 3.40.30.10
af_Q7XQA0_31_116_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9092 33 109 3.40.30.10
af_F4J6C9_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8624 35 107 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8436 32 120 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8357 30 124 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7X5F9R3-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.9577 33 109
AF-A0A645DI87-F1-model_v4 NADP-reducing hydrogenase subunit HndB (EC 1.12.1.3) 0.9519 35 130 GO:0050583
AF-A0A7Y4DEL8-F1-model_v4 NADH-quinone oxidoreductase subunit NuoF 0.9517 32 122 GO:0008137
GO:0010181
GO:0046872
GO:0051539
AF-A0A354KWB7-F1-model_v4 deleted 0.9501 35 123
AF-A0A353MUW0-F1-model_v4 deleted 0.9449 35 122

Feature Viewer

pLDDT pTM Quality
73.97 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map