F138561

General Info

Members Datasets Scaffolds Average Seq Length
128 114 256 202

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10014008|Ga0307508_100140086
Length 231
Sequence MSMTSTNLFRTDQYKRGTIDCMETRQKAPIGRPRGFDTDQALEHAMRVFWEQGYDGASLTDLTNAMGITRTSMYAAFGNKEDLFRKALERYTEGPASYGARALREPTARQVATAFLNGSVRATTRPGCPTGCFGVQGSLAAGDPGRNARDDLIAWRNEHTSHLRDRLRQAVEEGDLPPGADPGLLARYLMTVANGIAVQAASGTTRDDLQQVADMALRSWPPVTGPTQPTG

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
50 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
51 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
52 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
53 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
54 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
55 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
56 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
57 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
58 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
59 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
60 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
61 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
62 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
67 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
69 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
70 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
71 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
72 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
73 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
74 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
75 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
76 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
77 2508501050 Microvirga lupini Lut6 Isolate Nodule
78 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
79 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
80 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
81 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
82 2773857925 Microvirga vignae BR3299 Isolate Unclassified
83 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
84 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
85 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
86 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
87 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
88 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
89 2858882152 Micromonospora noduli MED15 Isolate Nodule
90 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
91 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
92 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
93 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
94 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
95 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
96 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
97 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
98 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
99 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
100 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
101 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
102 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
103 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
104 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
105 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
106 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
107 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
108 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
109 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
110 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
111 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
112 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
113 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
114 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.53
Metatranscriptomes 0
Isolates 30.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 5.47
Rhizoplane 2.34
Rhizosphere 60.16
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10014008 3300031616 Bacteria 7317
2 Ga0055536_1008550 3300003781 Bacteria 4385
3 Ga0070668_100602658 3300005347 Bacteria 961
4 Ga0070668_100611967 3300005347 Bacteria 954
5 Ga0070663_100406380 3300005455 Bacteria 1114
6 Ga0068853_100122401 3300005539 Bacteria 2322
7 Ga0070665_100002009 3300005548 Bacteria 22878
8 Ga0070665_100034288 3300005548 Bacteria 5105
9 Ga0068855_100097478 3300005563 Bacteria 3387
10 Ga0068854_100036597 3300005578 Bacteria 3442
11 Ga0068856_100728102 3300005614 Bacteria 1012
12 Ga0068852_100309279 3300005616 Bacteria 1532
13 Ga0068852_100824716 3300005616 Bacteria 942
14 Ga0068863_100631580 3300005841 Bacteria 1061
15 Ga0068860_100003783 3300005843 Bacteria 15573
16 Ga0081538_10002053 3300005981 Bacteria 20097
17 Ga0075362_10363597 3300006177 Bacteria 726
18 Ga0099795_10029658 3300007788 Bacteria 1871
19 Ga0105240_10937517 3300009093 Bacteria 929
20 Ga0105241_10033836 3300009174 Bacteria 3838
21 Ga0105237_10153195 3300009545 Bacteria 2302
22 Ga0105238_10070799 3300009551 Bacteria 3486
23 Ga0105239_10109118 3300010375 Bacteria 3066
24 Ga0157369_10472263 3300013105 Bacteria 1298
25 Ga0209676_1000097 3300025292 Bacteria 237203
26 Ga0209050_1037442 3300025298 Unclassified 1399
27 Ga0207426_1018705 3300025302 Bacteria 2437
28 Ga0207695_10105425 3300025913 Bacteria 2807
29 Ga0207671_10000589 3300025914 Bacteria 48540
30 Ga0207694_10022088 3300025924 Bacteria 4825
31 Ga0207694_10093353 3300025924 Bacteria 2377
32 Ga0207644_10009257 3300025931 Bacteria 6462
33 Ga0207667_10592172 3300025949 Bacteria 1119
34 Ga0207668_10199539 3300025972 Bacteria 1592
35 Ga0207640_10037466 3300025981 Bacteria 3051
36 Ga0207639_10163539 3300026041 Bacteria 1878
37 Ga0207678_10206865 3300026067 Bacteria 1679
38 Ga0207641_10098187 3300026088 Bacteria 2575
39 Ga0207698_10090969 3300026142 Bacteria 2497
40 Ga0268266_10056762 3300028379 Bacteria 3368
41 Ga0268266_10092301 3300028379 Bacteria 2656
42 Ga0268264_10036130 3300028381 Bacteria 4068
43 Ga0307513_10117089 3300031456 Bacteria 2642
44 Ga0307509_10183488 3300031507 Bacteria 1954
45 Ga0307509_10209916 3300031507 Bacteria 1773
46 Ga0307514_10046185 3300031649 Bacteria 3403
47 Ga0307516_10152169 3300031730 Bacteria 2072
48 Ga0307518_10370885 3300031838 Bacteria 819
49 Ga0307409_101265823 3300031995 Bacteria 762
50 Ga0395898_0007759 3300037466 Bacteria 11394
51 Ga0439465_0071867 3300041413 Bacteria 1161
52 Ga0466970_0326326 3300044765 Bacteria 868
53 Ga0466960_0234258 3300044901 Bacteria 1014
54 Ga0466967_0399050 3300045976 Bacteria 1338
55 Ga0466967_0582650 3300045976 Bacteria 1103
56 Ga0495666_0122231 3300046526 Bacteria 1219
57 Ga0495640_0003891 3300046533 Bacteria 11947
58 Ga0495667_0143240 3300046559 Bacteria 1540
59 Ga0495634_0039386 3300046642 Bacteria 3218
60 Ga0495657_0004412 3300046675 Bacteria 11229
61 Ga0495613_0040720 3300046689 Bacteria 3441
62 Ga0495687_005275 3300047443 Bacteria 8299
63 Ga0495685_143281 3300047447 Bacteria 778
64 Ga0495686_0075750 3300047472 Bacteria 2062
65 Ga0495593_0010870 3300047673 Bacteria 5246
66 Ga0495614_0046827 3300048089 Bacteria 1854
67 Ga0496113_0294122 3300048916 Bacteria 1300
68 Ga0496114_0250123 3300048917 Bacteria 1560
69 Ga0501032_0669963 3300049569 Bacteria 658
70 Ga0501036_0173542 3300049572 Bacteria 1816
71 Ga0501047_0145281 3300049581 Bacteria 2249
72 Ga0501047_0163353 3300049581 Bacteria 2098
73 Ga0501047_0338436 3300049581 Bacteria 1343
74 Ga0501070_0697101 3300049586 Bacteria 803
75 Ga0501072_1358830 3300049588 Bacteria 550
76 Ga0501035_0160734 3300049822 Bacteria 1944
77 Ga0501035_0611368 3300049822 Bacteria 887
78 Ga0501044_0184744 3300049823 Bacteria 2050
79 Ga0501044_0414495 3300049823 Bacteria 1258
80 Ga0501044_0858853 3300049823 Bacteria 784
81 nmdc:mga0sz30_231083_c1 3300050516 Bacteria 823
82 Ga0500556_0000729 3300053104 Bacteria 19824
83 Ga0500607_038900 3300053121 Bacteria 2586
84 Ga0500559_0070421 3300053136 Bacteria 1573
85 Ga0500586_002098 3300053145 Bacteria 4404
86 Ga0500616_0001941 3300053153 Bacteria 18457
87 Ga0500645_000181 3300053730 Bacteria 49626
88 Ga0500645_023483 3300053730 Bacteria 1890
89 Ga0530510_0020459 3300061734 Bacteria 4705
90 2508729959 2508501050 Bacteria 9633614
91 2585303046 2582581313 Bacteria 10042643
92 2686534891 2684623035 Bacteria 8032739
93 2739605156 2739367654 Bacteria 6049412
94 2768647907 2767802112 Bacteria 6465194
95 2774874127 2773857925 Bacteria 6472445
96 2793984479 2791355406 Bacteria 11364898
97 2808848942 2808606359 Bacteria 9866990
98 2855672500 2855670206 Bacteria 7120389
99 2855681849 2855676851 Bacteria 7063653
100 2857289061 2857288857 Bacteria 7189066
101 2858851634 2858848962 Bacteria 6963058
102 2858884595 2858882152 Bacteria 7230291
103 2858891178 2858888857 Bacteria 7060307
104 2858898359 2858895516 Bacteria 7378898
105 2867349740 2867346516 Bacteria 7608576
106 2869049049 2869048445 Bacteria 6875584
107 2869063288 2869061728 Bacteria 7112407
108 2869074130 2869068681 Bacteria 7205615
109 2873159062 2873151551 Bacteria 8625867
110 2880494685 2880489317 Bacteria 7096270
111 2895436984 2895427314 Bacteria 13147766
112 2917743488 2917736166 Bacteria 9690793
113 2929226199 2929219909 Bacteria 6984360
114 2929232854 2929226422 Bacteria 7248583
115 3006429478 3006425503 Bacteria 6491253
116 8025533961 8025530807 Bacteria 8495698
117 8047718944 8047710418 Bacteria 11023148
118 8047898221 8047893842 Bacteria 11723082
119 8048133153 8048127548 Bacteria 11053136
120 8048137424 8048127548 Bacteria 11053136
121 8048360673 8048356638 Bacteria 11044339
122 8048375183 8048369669 Bacteria 11666822
123 8048383022 8048379754 Bacteria 11877923
124 8054705408 8054704163 Bacteria 7247792
125 8054732476 8054727385 Bacteria 7558670
126 8054736536 8054734606 Bacteria 6947278
127 8055415734 8055412473 Bacteria 6257500
128 8056582486 8056579771 Bacteria 5840325
129 Ga0307508_10014008
130 Ga0055536_1008550
131 Ga0070668_100602658
132 Ga0070668_100611967
133 Ga0070663_100406380
134 Ga0068853_100122401
135 Ga0070665_100002009
136 Ga0070665_100034288
137 Ga0068855_100097478
138 Ga0068854_100036597
139 Ga0068856_100728102
140 Ga0068852_100309279
141 Ga0068852_100824716
142 Ga0068863_100631580
143 Ga0068860_100003783
144 Ga0081538_10002053
145 Ga0075362_10363597
146 Ga0099795_10029658
147 Ga0105240_10937517
148 Ga0105241_10033836
149 Ga0105237_10153195
150 Ga0105238_10070799
151 Ga0105239_10109118
152 Ga0157369_10472263
153 Ga0209676_1000097
154 Ga0209050_1037442
155 Ga0207426_1018705
156 Ga0207695_10105425
157 Ga0207671_10000589
158 Ga0207694_10022088
159 Ga0207694_10093353
160 Ga0207644_10009257
161 Ga0207667_10592172
162 Ga0207668_10199539
163 Ga0207640_10037466
164 Ga0207639_10163539
165 Ga0207678_10206865
166 Ga0207641_10098187
167 Ga0207698_10090969
168 Ga0268266_10056762
169 Ga0268266_10092301
170 Ga0268264_10036130
171 Ga0307513_10117089
172 Ga0307509_10183488
173 Ga0307509_10209916
174 Ga0307514_10046185
175 Ga0307516_10152169
176 Ga0307518_10370885
177 Ga0307409_101265823
178 Ga0395898_0007759
179 Ga0439465_0071867
180 Ga0466970_0326326
181 Ga0466960_0234258
182 Ga0466967_0399050
183 Ga0466967_0582650
184 Ga0495666_0122231
185 Ga0495640_0003891
186 Ga0495667_0143240
187 Ga0495634_0039386
188 Ga0495657_0004412
189 Ga0495613_0040720
190 Ga0495687_005275
191 Ga0495685_143281
192 Ga0495686_0075750
193 Ga0495593_0010870
194 Ga0495614_0046827
195 Ga0496113_0294122
196 Ga0496114_0250123
197 Ga0501032_0669963
198 Ga0501036_0173542
199 Ga0501047_0145281
200 Ga0501047_0163353
201 Ga0501047_0338436
202 Ga0501070_0697101
203 Ga0501072_1358830
204 Ga0501035_0160734
205 Ga0501035_0611368
206 Ga0501044_0184744
207 Ga0501044_0414495
208 Ga0501044_0858853
209 nmdc:mga0sz30_231083_c1
210 Ga0500556_0000729
211 Ga0500607_038900
212 Ga0500559_0070421
213 Ga0500586_002098
214 Ga0500616_0001941
215 Ga0500645_000181
216 Ga0500645_023483
217 Ga0530510_0020459
218 2508729959
219 2585303046
220 2686534891
221 2739605156
222 2768647907
223 2774874127
224 2793984479
225 2808848942
226 2855672500
227 2855681849
228 2857289061
229 2858851634
230 2858884595
231 2858891178
232 2858898359
233 2867349740
234 2869049049
235 2869063288
236 2869074130
237 2873159062
238 2880494685
239 2895436984
240 2917743488
241 2929226199
242 2929232854
243 3006429478
244 8025533961
245 8047718944
246 8047898221
247 8048133153
248 8048137424
249 8048360673
250 8048375183
251 8048383022
252 8054705408
253 8054732476
254 8054736536
255 8055415734
256 8056582486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

41

87

0.96

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

108

216

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.9213 3 192
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.9194 2 192
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.9122 3 192
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.9103 2 192
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8471 10 195
ID Description Score Start End Superfamily
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9348 10 57 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9345 11 57 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9321 10 57 1.10.10.60
3bqzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9292 10 54 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9283 10 50 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A841JWR7-F1-model_v4 AcrR family transcriptional regulator 0.966 1 192 GO:0003677
GO:0006355
AF-A0A6A7Y1J8-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9646 1 194 GO:0003677
GO:0006355
AF-A0A5R9J919-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9615 1 195 GO:0003677
GO:0006355
AF-A0A7Z0IXM0-F1-model_v4 AcrR family transcriptional regulator 0.9602 1 193 GO:0003677
GO:0006355
AF-A0A7W9RD07-F1-model_v4 deleted 0.9593 15 193

Map