F135468

General Info

Members Datasets Scaffolds Average Seq Length
127 82 254 258

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0265730|Ga0495664_0265730_46_915
Length 289
Sequence MNALLLGFGHHQAGVPLAFSFSFRILPGAQFDVFMVMERVNILGVGVSVINLPTALAAIGDAVGARRKGYVCVTGVHGVMEAQTDAGFRSILNRAFLCTPDGMPMVWMGRLRGHRAMRRVYGPDLMLEIFAWSRENPCRHFFYGGAPGVAEALRQKMMARFPDLQVVGCYTPPFRALNAGEQGQLEEMVRAARPDILWVGLSTPKQEKFMAEFLPRLDVTLMVGVGAAFDFHSGRVRQAPRWMQRSGLEWFFRLCQEPRRLAKRYLQNNPRFALKIAGQLAGLKTYSLE

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
65 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
82 2643221545 Caulobacter sp. Root1455 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 0
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 22.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0265730 3300046477 Bacteria 1037
2 rootH2_10113509 3300003320 Unclassified 3202
3 Ga0070683_100082439 3300005329 Bacteria 3012
4 Ga0070660_100188914 3300005339 Unclassified 1668
5 Ga0070711_100002476 3300005439 Bacteria 10547
6 Ga0070700_100216940 3300005441 Bacteria 1353
7 Ga0070708_100668512 3300005445 Bacteria 978
8 Ga0070706_100098868 3300005467 Unclassified 2711
9 Ga0070707_100090930 3300005468 Bacteria 2954
10 Ga0070707_100271637 3300005468 Bacteria 1648
11 Ga0070698_100117535 3300005471 Bacteria 2621
12 Ga0070699_100140088 3300005518 Bacteria 2135
13 Ga0070684_100227309 3300005535 Unclassified 1703
14 Ga0070697_100023996 3300005536 Unclassified 4853
15 Ga0070697_100246246 3300005536 Bacteria 1527
16 Ga0068855_100011851 3300005563 Bacteria 10541
17 Ga0070664_100035769 3300005564 Unclassified 4170
18 Ga0068857_100008168 3300005577 Bacteria 9040
19 Ga0068859_100024157 3300005617 Bacteria 6098
20 Ga0068859_100102542 3300005617 Unclassified 2919
21 Ga0068864_100708042 3300005618 Bacteria 984
22 Ga0068863_100023953 3300005841 Bacteria 5827
23 Ga0068858_100001790 3300005842 Bacteria 21918
24 Ga0068858_100342844 3300005842 Bacteria 1430
25 Ga0068862_100004330 3300005844 Bacteria 12015
26 Ga0097620_100024157 3300006931 Bacteria 6098
27 Ga0097620_100102544 3300006931 Unclassified 2919
28 Ga0099794_10004875 3300007265 Bacteria 5330
29 Ga0105240_10383168 3300009093 Bacteria 1587
30 Ga0105247_10067540 3300009101 Unclassified 2228
31 Ga0157378_10802214 3300013297 Bacteria 967
32 Ga0157372_10416838 3300013307 Bacteria 1565
33 Ga0157372_11296348 3300013307 Bacteria 841
34 Ga0207684_10021667 3300025910 Bacteria 5487
35 Ga0207663_10000705 3300025916 Bacteria 14859
36 Ga0207646_10059597 3300025922 Bacteria 3409
37 Ga0207646_10241001 3300025922 Bacteria 1634
38 Ga0207681_10071641 3300025923 Bacteria 2418
39 Ga0207694_10094170 3300025924 Bacteria 2367
40 Ga0207679_10062979 3300025945 Unclassified 2766
41 Ga0207703_10001370 3300026035 Bacteria 22258
42 Ga0207708_10277543 3300026075 Bacteria 1357
43 Ga0207674_10007568 3300026116 Bacteria 12654
44 Ga0268265_10005092 3300028380 Bacteria 9013
45 Ga0265337_1000038 3300028556 Bacteria 57620
46 Ga0265337_1029238 3300028556 Unclassified 1649
47 Ga0265337_1042146 3300028556 Unclassified 1310
48 Ga0265337_1050777 3300028556 Bacteria 1168
49 Ga0265326_10076921 3300028558 Unclassified 944
50 Ga0265319_1000001 3300028563 Bacteria 549513
51 Ga0265319_1014035 3300028563 Bacteria 3158
52 Ga0265334_10009458 3300028573 Bacteria 4123
53 Ga0265318_10097318 3300028577 Unclassified 1083
54 Ga0265323_10000518 3300028653 Bacteria 21450
55 Ga0265323_10010547 3300028653 Unclassified 3742
56 Ga0265323_10017892 3300028653 Unclassified 2748
57 Ga0265338_10000458 3300028800 Bacteria 72770
58 Ga0265338_10000629 3300028800 Bacteria 61303
59 Ga0265338_10005590 3300028800 Bacteria 16351
60 Ga0265338_10008831 3300028800 Bacteria 12158
61 Ga0265338_10016235 3300028800 Bacteria 8115
62 Ga0265338_10019539 3300028800 Bacteria 7180
63 Ga0265338_10023747 3300028800 Bacteria 6289
64 Ga0265338_10028471 3300028800 Bacteria 5571
65 Ga0265338_10043978 3300028800 Unclassified 4130
66 Ga0265338_10050387 3300028800 Unclassified 3764
67 Ga0265338_10061856 3300028800 Unclassified 3278
68 Ga0265338_10078663 3300028800 Bacteria 2780
69 Ga0265338_10128988 3300028800 Bacteria 2001
70 Ga0265338_10258001 3300028800 Bacteria 1283
71 Ga0265332_10176745 3300031238 Bacteria 890
72 Ga0265320_10000665 3300031240 Bacteria 26247
73 Ga0265320_10004394 3300031240 Bacteria 9244
74 Ga0265320_10034631 3300031240 Unclassified 2567
75 Ga0265320_10053814 3300031240 Bacteria 1943
76 Ga0265325_10021193 3300031241 Bacteria 3575
77 Ga0265325_10058672 3300031241 Unclassified 1959
78 Ga0265329_10102444 3300031242 Unclassified 912
79 Ga0265340_10000442 3300031247 Bacteria 22361
80 Ga0265340_10023599 3300031247 Bacteria 3135
81 Ga0265339_10038876 3300031249 Bacteria 2651
82 Ga0265339_10179821 3300031249 Bacteria 1054
83 Ga0265327_10020340 3300031251 Bacteria 4048
84 Ga0265316_10002196 3300031344 Bacteria 20502
85 Ga0265316_10028720 3300031344 Unclassified 4585
86 Ga0265316_10042900 3300031344 Bacteria 3611
87 Ga0265316_10070917 3300031344 Bacteria 2687
88 Ga0265316_10110916 3300031344 Bacteria 2077
89 Ga0265316_10135542 3300031344 Bacteria 1852
90 Ga0265316_10390595 3300031344 Bacteria 1003
91 Ga0265313_10001166 3300031595 Bacteria 25120
92 Ga0265313_10004128 3300031595 Bacteria 11290
93 Ga0265313_10041699 3300031595 Bacteria 2259
94 Ga0265314_10036187 3300031711 Bacteria 3590
95 Ga0265314_10158439 3300031711 Bacteria 1380
96 Ga0265314_10214464 3300031711 Unclassified 1128
97 Ga0373954_0000193 3300035118 Bacteria 22040
98 Ga0373937_0000906 3300036401 Bacteria 25219
99 Ga0395901_0004137 3300038443 Bacteria 14633
100 Ga0453683_0323060 3300044673 Unclassified 989
101 Ga0453684_0990239 3300044712 Unclassified 895
102 Ga0466960_0154191 3300044901 Bacteria 1229
103 Ga0451576_0190081 3300045051 Bacteria 2144
104 Ga0451576_0876394 3300045051 Unclassified 942
105 Ga0495618_0005902 3300046514 Bacteria 7443
106 Ga0495630_0143395 3300046517 Unclassified 1816
107 Ga0495640_0580142 3300046533 Unclassified 678
108 Ga0495622_0074752 3300046557 Bacteria 1562
109 Ga0495634_0002606 3300046642 Bacteria 14836
110 Ga0495613_0000999 3300046689 Bacteria 21503
111 Ga0495680_0002498 3300047322 Bacteria 18806
112 Ga0501031_0000841 3300049568 Bacteria 18445
113 Ga0501032_0000359 3300049569 Bacteria 37996
114 Ga0501033_0000072 3300049570 Bacteria 95370
115 Ga0501033_0001939 3300049570 Bacteria 18011
116 Ga0501034_0125672 3300049571 Bacteria 2550
117 Ga0501038_0001837 3300049574 Bacteria 19631
118 Ga0501038_0465196 3300049574 Bacteria 971
119 Ga0501075_0128558 3300049591 Bacteria 1929
120 Ga0501076_0006125 3300049592 Bacteria 8707
121 Ga0501080_0319813 3300049742 Bacteria 1405
122 Ga0501081_0066805 3300049743 Bacteria 2501
123 Ga0501035_0003431 3300049822 Bacteria 15161
124 Ga0501044_0000232 3300049823 Bacteria 70100
125 Ga0501045_0098955 3300049824 Bacteria 2158
126 Ga0500622_0016435 3300053156 Bacteria 3954
127 2643748850 2643221545 Bacteria 5083237
128 Ga0495664_0265730
129 rootH2_10113509
130 Ga0070683_100082439
131 Ga0070660_100188914
132 Ga0070711_100002476
133 Ga0070700_100216940
134 Ga0070708_100668512
135 Ga0070706_100098868
136 Ga0070707_100090930
137 Ga0070707_100271637
138 Ga0070698_100117535
139 Ga0070699_100140088
140 Ga0070684_100227309
141 Ga0070697_100023996
142 Ga0070697_100246246
143 Ga0068855_100011851
144 Ga0070664_100035769
145 Ga0068857_100008168
146 Ga0068859_100024157
147 Ga0068859_100102542
148 Ga0068864_100708042
149 Ga0068863_100023953
150 Ga0068858_100001790
151 Ga0068858_100342844
152 Ga0068862_100004330
153 Ga0097620_100024157
154 Ga0097620_100102544
155 Ga0099794_10004875
156 Ga0105240_10383168
157 Ga0105247_10067540
158 Ga0157378_10802214
159 Ga0157372_10416838
160 Ga0157372_11296348
161 Ga0207684_10021667
162 Ga0207663_10000705
163 Ga0207646_10059597
164 Ga0207646_10241001
165 Ga0207681_10071641
166 Ga0207694_10094170
167 Ga0207679_10062979
168 Ga0207703_10001370
169 Ga0207708_10277543
170 Ga0207674_10007568
171 Ga0268265_10005092
172 Ga0265337_1000038
173 Ga0265337_1029238
174 Ga0265337_1042146
175 Ga0265337_1050777
176 Ga0265326_10076921
177 Ga0265319_1000001
178 Ga0265319_1014035
179 Ga0265334_10009458
180 Ga0265318_10097318
181 Ga0265323_10000518
182 Ga0265323_10010547
183 Ga0265323_10017892
184 Ga0265338_10000458
185 Ga0265338_10000629
186 Ga0265338_10005590
187 Ga0265338_10008831
188 Ga0265338_10016235
189 Ga0265338_10019539
190 Ga0265338_10023747
191 Ga0265338_10028471
192 Ga0265338_10043978
193 Ga0265338_10050387
194 Ga0265338_10061856
195 Ga0265338_10078663
196 Ga0265338_10128988
197 Ga0265338_10258001
198 Ga0265332_10176745
199 Ga0265320_10000665
200 Ga0265320_10004394
201 Ga0265320_10034631
202 Ga0265320_10053814
203 Ga0265325_10021193
204 Ga0265325_10058672
205 Ga0265329_10102444
206 Ga0265340_10000442
207 Ga0265340_10023599
208 Ga0265339_10038876
209 Ga0265339_10179821
210 Ga0265327_10020340
211 Ga0265316_10002196
212 Ga0265316_10028720
213 Ga0265316_10042900
214 Ga0265316_10070917
215 Ga0265316_10110916
216 Ga0265316_10135542
217 Ga0265316_10390595
218 Ga0265313_10001166
219 Ga0265313_10004128
220 Ga0265313_10041699
221 Ga0265314_10036187
222 Ga0265314_10158439
223 Ga0265314_10214464
224 Ga0373954_0000193
225 Ga0373937_0000906
226 Ga0395901_0004137
227 Ga0453683_0323060
228 Ga0453684_0990239
229 Ga0466960_0154191
230 Ga0451576_0190081
231 Ga0451576_0876394
232 Ga0495618_0005902
233 Ga0495630_0143395
234 Ga0495640_0580142
235 Ga0495622_0074752
236 Ga0495634_0002606
237 Ga0495613_0000999
238 Ga0495680_0002498
239 Ga0501031_0000841
240 Ga0501032_0000359
241 Ga0501033_0000072
242 Ga0501033_0001939
243 Ga0501034_0125672
244 Ga0501038_0001837
245 Ga0501038_0465196
246 Ga0501075_0128558
247 Ga0501076_0006125
248 Ga0501080_0319813
249 Ga0501081_0066805
250 Ga0501035_0003431
251 Ga0501044_0000232
252 Ga0501045_0098955
253 Ga0500622_0016435
254 2643748850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03808

Glyco_tran_WecG

Glycosyl transferase WecG/TagA/CpsF family

95

265

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wfg-assembly2.cif.gz_F crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9413 4 199
5wfg-assembly1.cif.gz_C crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9411 4 199
5wfg-assembly2.cif.gz_D crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.9408 4 199
5wfg-assembly2.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.94 3 199
5wb4-assembly1.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase 0.9393 3 197
ID Description Score Start End Superfamily
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8764 60 228 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8719 60 229 3.40.50.2300
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8667 60 228 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8624 60 229 3.40.50.2300
af_Q2G142_402_487_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6869 105 164 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A380TBE5-F1-model_v4 Glycosyl transferase 0.9848 2 254 GO:0009058
GO:0016758
AF-A0A7X7VKV5-F1-model_v4 deleted 0.9836 2 254
AF-A0A2V9X8S2-F1-model_v4 Glycosyltransferase 0.9827 2 254 GO:0009058
GO:0016758
AF-A0A4Q2XYK7-F1-model_v4 Glycosyltransferase 0.9823 2 184 GO:0009058
GO:0016758
AF-A0A1F8NW78-F1-model_v4 Glycosyl transferase 0.9822 2 254 GO:0009058
GO:0016758

Map