F135403

General Info

Members Datasets Scaffolds Average Seq Length
127 103 89 279

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_036939|Ga0495627_036939_222_1124
Length 300
Sequence LLFKSNSALAKTYLNQTKKINKMSSIISPSQLKNLPTENLIILDARVGKDIHQTYLNHHIKGARFIDLDKDLAEIGEDAAFGGRHPLPDVEKFAETLSNLGISEDSHIVIYDDKNGANAAARAWWMLKSFGFEKVQVLDGGFQAAEKEGVEFSSSEEIFEKTELIKKDNWLLPTSMLETVENELINNSSTVIDVRDAYRYNGESEPIDLIAGHIPGAINIPFSENLDENGNFLSPEILKEKYSKLLQGKPQNLIIHCGSGVTACHTILALDYAGLEIPNLYVGSWSEWSRREGKEIAKEI

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
20 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
23 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
24 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
29 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
30 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
31 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
32 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
33 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
34 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
35 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
36 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
37 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
38 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
103 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.08
Metatranscriptomes 0
Isolates 29.92

Biome Distribution

Category Percentage (%)
Aerial Root 1.57
Bulb 0
Endosphere 0.79
Nodule 0.79
Rhizoplane 1.57
Rhizosphere 73.23
Stem 0
Stem Tuber 0
Unclassified 22.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000054 3300001915 Bacteria 28265
2 rootH2_10065994 3300003320 Bacteria 3253
3 rootH1_10058790 3300003323 Bacteria 9765
4 Ga0065714_10002224 3300005288 Bacteria 45363
5 Ga0065704_10073892 3300005289 Bacteria 6697
6 Ga0070683_100000389 3300005329 Bacteria 30361
7 Ga0070682_100000062 3300005337 Bacteria 105099
8 Ga0070660_100017934 3300005339 Bacteria 5165
9 Ga0070668_100021662 3300005347 Bacteria 4856
10 Ga0070668_100123863 3300005347 Bacteria 2069
11 Ga0070684_100001183 3300005535 Bacteria 18755
12 Ga0068863_100126828 3300005841 Bacteria 2435
13 Ga0105244_10000005 3300009036 Bacteria 481412
14 Ga0105250_10004753 3300009092 Bacteria 6195
15 Ga0111539_10008677 3300009094 Bacteria 12901
16 Ga0105243_10000064 3300009148 Bacteria 126487
17 Ga0105243_10034694 3300009148 Bacteria 3908
18 Ga0157373_10000158 3300013100 Bacteria 54838
19 Ga0157371_10000012 3300013102 Bacteria 355318
20 Ga0157371_10333286 3300013102 Bacteria 1103
21 Ga0157370_10017557 3300013104 Bacteria 7219
22 Ga0157370_10056991 3300013104 Bacteria 3717
23 Ga0157370_10095238 3300013104 Bacteria 2793
24 Ga0157370_10258125 3300013104 Bacteria 1611
25 Ga0157370_10620722 3300013104 Bacteria 989
26 Ga0157369_10002543 3300013105 Bacteria 21814
27 Ga0157375_10047940 3300013308 Bacteria 4176
28 Ga0157375_10454307 3300013308 Bacteria 1447
29 Ga0182008_10000005 3300014497 Bacteria 386556
30 Ga0182006_1000001 3300015261 Bacteria 1091090
31 Ga0163161_10005847 3300017792 Bacteria 8526
32 Ga0209675_1000022 3300025291 Bacteria 315280
33 Ga0207655_1000016 3300025728 Bacteria 551476
34 Ga0207657_10054000 3300025919 Bacteria 3477
35 Ga0207709_10000080 3300025935 Bacteria 165667
36 Ga0207709_10212935 3300025935 Bacteria 1388
37 Ga0207661_10000466 3300025944 Bacteria 26139
38 Ga0207668_10004039 3300025972 Bacteria 8627
39 Ga0207668_10042239 3300025972 Bacteria 3087
40 Ga0207641_10200831 3300026088 Bacteria 1838
41 Ga0207641_10329913 3300026088 Bacteria 1449
42 Ga0307515_10219718 3300028794 Bacteria 1721
43 Ga0307413_10000058 3300031824 Bacteria 28566
44 Ga0307412_10000006 3300031911 Bacteria 506878
45 Ga0307412_10000419 3300031911 Bacteria 25928
46 Ga0307416_100000021 3300032002 Bacteria 189730
47 Ga0307414_10000025 3300032004 Bacteria 199049
48 Ga0307414_10079525 3300032004 Bacteria 2394
49 Ga0307414_10127147 3300032004 Bacteria 1971
50 Ga0439465_0000022 3300041413 Bacteria 31864
51 Ga0439445_0000155 3300042004 Bacteria 12086
52 Ga0495627_000012 3300046453 Bacteria 345654
53 Ga0495627_036939 3300046453 Bacteria 1516
54 Ga0495590_0002815 3300046457 Bacteria 7176
55 Ga0495606_0003893 3300046507 Bacteria 15383
56 Ga0495610_0000005 3300046512 Bacteria 924111
57 Ga0495632_0001915 3300046519 Bacteria 16644
58 Ga0495643_0039489 3300046522 Bacteria 2581
59 Ga0495648_0021092 3300046524 Bacteria 4523
60 Ga0495663_0000018 3300046525 Bacteria 131320
61 Ga0495654_0000003 3300046530 Bacteria 863485
62 Ga0495609_0000003 3300046538 Bacteria 711547
63 Ga0495633_0000001 3300046558 Bacteria 801972
64 Ga0495633_0000536 3300046558 Bacteria 37862
65 Ga0495625_0000148 3300046660 Bacteria 106591
66 Ga0495686_0000224 3300047472 Bacteria 104239
67 Ga0495686_0002285 3300047472 Bacteria 18398
68 Ga0496103_0067990 3300048906 Bacteria 2226
69 Ga0496113_0047739 3300048916 Bacteria 3183
70 Ga0496116_0000051 3300048919 Bacteria 305038
71 Ga0496117_0000007 3300048920 Bacteria 720505
72 Ga0496118_0000140 3300048921 Bacteria 128335
73 Ga0496119_0000028 3300048922 Bacteria 244677
74 Ga0496120_0050476 3300048923 Bacteria 2382
75 Ga0496121_0051496 3300048924 Bacteria 3467
76 Ga0496122_0000181 3300048925 Bacteria 148788
77 Ga0496122_0000237 3300048925 Bacteria 123935
78 Ga0496122_0000422 3300048925 Bacteria 89784
79 Ga0496122_0000656 3300048925 Bacteria 69796
80 Ga0496122_0022558 3300048925 Bacteria 5590
81 Ga0496123_0000837 3300048926 Bacteria 49265
82 Ga0496123_0004919 3300048926 Bacteria 13708
83 Ga0496124_0002500 3300048927 Bacteria 23919
84 Ga0496125_0001246 3300048928 Bacteria 38028
85 Ga0496125_0005595 3300048928 Bacteria 13877
86 Ga0496125_0016636 3300048928 Bacteria 7053
87 Ga0496126_0013847 3300048929 Bacteria 8182
88 Ga0501241_000001 3300049758 Bacteria 233688
89 Ga0501269_000093 3300049766 Bacteria 28080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10005847 Ga0163161_100058479 267
2 3300005289 Ga0065704_10073892 Ga0065704_100738922 270
3 3300009148 Ga0105243_10034694 Ga0105243_100346945 270
4 3300013102 Ga0157371_10000012 Ga0157371_1000001249 270
5 3300013104 Ga0157370_10017557 Ga0157370_100175572 270
6 3300013105 Ga0157369_10002543 Ga0157369_100025432 270
7 3300025935 Ga0207709_10212935 Ga0207709_102129352 270
8 3300046457 Ga0495590_0002815 Ga0495590_0002815_1510_2331 270
9 3300013104 Ga0157370_10620722 Ga0157370_106207221 273
10 iso_pu_bacteria 2902048731 2902051958 273
11 iso_pu_bacteria 2582581278 2585141266 274
12 iso_pu_bacteria 2585428045 2587676879 274
13 iso_pu_bacteria 2585428060 2587746634 274
14 iso_pu_bacteria 2585428095 2587866066 274
15 iso_pu_bacteria 2585428115 2587944485 274
16 iso_pu_bacteria 2585428182 2588211082 274
17 iso_pu_bacteria 2585428183 2588215501 274
18 iso_pu_bacteria 2585428184 2588218912 274
19 iso_pu_bacteria 2585428185 2588224410 274
20 iso_pu_bacteria 2585428187 2588232177 274
21 iso_pu_bacteria 2588253712 2588447163 274
22 iso_pu_bacteria 2588254255 2590602819 274
23 iso_pu_bacteria 2588254257 2590609802 274
24 iso_pu_bacteria 2728369107 2729201181 274
25 iso_pu_bacteria 2739367874 2740060077 274
26 iso_pu_bacteria 2751185877 2753673858 274
27 iso_pu_bacteria 2765235839 2765575272 274
28 iso_pu_bacteria 2772190705 2772603276 274
29 iso_pu_bacteria 2775506739 2775674642 274
30 iso_pu_bacteria 2816332188 2816875124 274
31 iso_pu_bacteria 2842083920 2842084662 274
32 iso_pu_bacteria 2871720351 2871723213 274
33 iso_pu_bacteria 2889290771 2889294194 274
34 iso_pu_bacteria 2905999023 2905999357 274
35 iso_pu_bacteria 2919097161 2919098258 274
36 iso_pu_bacteria 2919399522 2919401642 274
37 iso_pu_bacteria 2945924605 2945925318 274
38 iso_pu_bacteria 2946019816 2946023705 274
39 iso_pu_bacteria 2977243572 2977244108 274
40 iso_pu_bacteria 2993372514 2993375608 274
41 iso_pu_bacteria 2993480792 2993482477 274
42 iso_pu_bacteria 2582581873 2585426196 275
43 3300009094 Ga0111539_10008677 Ga0111539_100086775 276
44 3300005841 Ga0068863_100126828 Ga0068863_1001268283 277
45 3300026088 Ga0207641_10200831 Ga0207641_102008312 277
46 3300026088 Ga0207641_10329913 Ga0207641_103299132 277
47 3300028794 Ga0307515_10219718 Ga0307515_102197182 277
48 3300046524 Ga0495648_0021092 Ga0495648_0021092_40_876 277
49 3300001915 JGI24741J21665_1000054 JGI24741J21665_100005425 278
50 3300003320 rootH2_10065994 rootH2_100659942 278
51 3300003323 rootH1_10058790 rootH1_100587905 278
52 3300005288 Ga0065714_10002224 Ga0065714_1000222437 278
53 3300005329 Ga0070683_100000389 Ga0070683_10000038921 278
54 3300005337 Ga0070682_100000062 Ga0070682_10000006251 278
55 3300005339 Ga0070660_100017934 Ga0070660_1000179341 278
56 3300005347 Ga0070668_100021662 Ga0070668_1000216622 278
57 3300005347 Ga0070668_100123863 Ga0070668_1001238631 278
58 3300005535 Ga0070684_100001183 Ga0070684_1000011837 278
59 3300009036 Ga0105244_10000005 Ga0105244_1000000541 278
60 3300009092 Ga0105250_10004753 Ga0105250_100047533 278
61 3300009148 Ga0105243_10000064 Ga0105243_1000006484 278
62 3300013100 Ga0157373_10000158 Ga0157373_1000015850 278
63 3300013102 Ga0157371_10333286 Ga0157371_103332861 278
64 3300013104 Ga0157370_10056991 Ga0157370_100569912 278
65 3300013104 Ga0157370_10095238 Ga0157370_100952383 278
66 3300013104 Ga0157370_10258125 Ga0157370_102581252 278
67 3300013308 Ga0157375_10047940 Ga0157375_100479407 278
68 3300013308 Ga0157375_10454307 Ga0157375_104543071 278
69 3300014497 Ga0182008_10000005 Ga0182008_10000005161 278
70 3300015261 Ga0182006_1000001 Ga0182006_1000001460 278
71 3300025291 Ga0209675_1000022 Ga0209675_1000022140 278
72 3300025728 Ga0207655_1000016 Ga0207655_100001641 278
73 3300025919 Ga0207657_10054000 Ga0207657_100540007 278
74 3300025935 Ga0207709_10000080 Ga0207709_1000008064 278
75 3300025944 Ga0207661_10000466 Ga0207661_1000046622 278
76 3300025972 Ga0207668_10004039 Ga0207668_100040392 278
77 3300025972 Ga0207668_10042239 Ga0207668_100422391 278
78 3300031824 Ga0307413_10000058 Ga0307413_1000005817 278
79 3300031911 Ga0307412_10000006 Ga0307412_10000006491 278
80 3300031911 Ga0307412_10000419 Ga0307412_1000041911 278
81 3300032002 Ga0307416_100000021 Ga0307416_10000002118 278
82 3300032004 Ga0307414_10000025 Ga0307414_1000002535 278
83 3300032004 Ga0307414_10079525 Ga0307414_100795252 278
84 3300032004 Ga0307414_10127147 Ga0307414_101271472 278
85 3300041413 Ga0439465_0000022 Ga0439465_0000022_1550_2386 278
86 3300042004 Ga0439445_0000155 Ga0439445_0000155_1041_1877 278
87 3300046453 Ga0495627_000012 Ga0495627_000012_228969_229808 278
88 3300046453 Ga0495627_036939 Ga0495627_036939_222_1124 278
89 3300046507 Ga0495606_0003893 Ga0495606_0003893_3333_4175 278
90 3300046512 Ga0495610_0000005 Ga0495610_0000005_606624_607460 278
91 3300046519 Ga0495632_0001915 Ga0495632_0001915_15538_16422 278
92 3300046522 Ga0495643_0039489 Ga0495643_0039489_117_1019 278
93 3300046525 Ga0495663_0000018 Ga0495663_0000018_116873_117709 278
94 3300046530 Ga0495654_0000003 Ga0495654_0000003_371781_372617 278
95 3300046538 Ga0495609_0000003 Ga0495609_0000003_379300_380187 278
96 3300046558 Ga0495633_0000001 Ga0495633_0000001_462621_463457 278
97 3300046558 Ga0495633_0000536 Ga0495633_0000536_10975_11859 278
98 3300046660 Ga0495625_0000148 Ga0495625_0000148_48275_49159 278
99 3300047472 Ga0495686_0000224 Ga0495686_0000224_41608_42510 278
100 3300047472 Ga0495686_0002285 Ga0495686_0002285_689_1528 278
101 3300048906 Ga0496103_0067990 Ga0496103_0067990_455_1291 278
102 3300048916 Ga0496113_0047739 Ga0496113_0047739_313_1149 278
103 3300048919 Ga0496116_0000051 Ga0496116_0000051_217963_218799 278
104 3300048920 Ga0496117_0000007 Ga0496117_0000007_502450_503286 278
105 3300048921 Ga0496118_0000140 Ga0496118_0000140_72635_73471 278
106 3300048922 Ga0496119_0000028 Ga0496119_0000028_217118_217954 278
107 3300048923 Ga0496120_0050476 Ga0496120_0050476_1439_2275 278
108 3300048924 Ga0496121_0051496 Ga0496121_0051496_2404_3240 278
109 3300048925 Ga0496122_0000181 Ga0496122_0000181_53135_53971 278
110 3300048925 Ga0496122_0000237 Ga0496122_0000237_51000_51836 278
111 3300048925 Ga0496122_0000422 Ga0496122_0000422_38414_39250 278
112 3300048925 Ga0496122_0000656 Ga0496122_0000656_40903_41739 278
113 3300048925 Ga0496122_0022558 Ga0496122_0022558_1121_1960 278
114 3300048926 Ga0496123_0000837 Ga0496123_0000837_45907_46743 278
115 3300048926 Ga0496123_0004919 Ga0496123_0004919_6324_7160 278
116 3300048927 Ga0496124_0002500 Ga0496124_0002500_1017_1853 278
117 3300048928 Ga0496125_0001246 Ga0496125_0001246_1296_2132 278
118 3300048928 Ga0496125_0005595 Ga0496125_0005595_1170_2006 278
119 3300048928 Ga0496125_0016636 Ga0496125_0016636_3233_4069 278
120 3300048929 Ga0496126_0013847 Ga0496126_0013847_4237_5109 278
121 3300049758 Ga0501241_000001 Ga0501241_000001_120810_121646 278
122 3300049766 Ga0501269_000093 Ga0501269_000093_24356_25192 278
123 iso_pu_bacteria 2511231000 2511233696 278
124 iso_pu_bacteria 2582581281 2585157103 278
125 iso_pu_bacteria 2582581282 2585161243 278
126 iso_pu_bacteria 2984572630 2984573959 278
127 iso_pu_bacteria 2984606641 2984607406 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

28

148

0.83

PF00581

Rhodanese

Rhodanese-like domain

176

291

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1urh-assembly1.cif.gz_A "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8594 1 263
1urh-assembly1.cif.gz_A "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8502 1 263
1h4m-assembly1.cif.gz_X sulfurtransferase from azotobacter vinelandii in complex with phosphate 0.8429 1 266
1urh-assembly2.cif.gz_B "the ""rhodanese"" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli" 0.8424 1 264
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.8413 1 271
ID Description Score Start End Superfamily
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8912 4 143 3.40.250.10
af_Q54E40_34_193_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.854 2 133 3.40.250.10
af_Q4DV84_20_177_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8459 2 148 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.845 1 136 3.40.250.10
1h4mX01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8378 1 143 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A4U8WN55-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9435 1 155 GO:0004792
GO:0016784
AF-A0A4U8WN55-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9378 1 155 GO:0004792
GO:0016784
AF-A0A2S9ISI3-F1-model_v4 Sulfurtransferase 0.9332 1 175 GO:0004792
AF-A0A1G0RIZ6-F1-model_v4 Sulfurtransferase 0.928 1 268 GO:0004792
AF-A0A1M4YT90-F1-model_v4 Thiosulfate/3-mercaptopyruvate sulfurtransferase 0.9263 1 278 GO:0004792

Feature Viewer

pLDDT pTM Quality
88.82 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map