F134418

General Info

Members Datasets Scaffolds Average Seq Length
127 68 254 290

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10005919|Ga0213874_100059193
Length 316
Sequence MERLYPRLPVPITGYGATVIDTGPQRRQLTPLEPVMEAIESAEVLDAPGKALGKKIREIVPRGPVKDALSGTWLGHAVHPMLTDVVIGSFASASLLDLLAPDADGVASQRLIALGLAAYLPTAAAGANDWADTEVVDDTIRRAGVVHASGNAIAATLYFASLRARRRGARGRGAVLGFAGMSVLMAGGYLGGHLSLNKGVGPAQTVFDPGPTDWTPAADAAQLKEGQPVRVVVDDTPVLLLRRGERTFAIHDRCSHRGCSLSEGEVEGEEIVCACHGSRFDLRNGAVRGGPATSAQPSFQVRVEEGRLEVRRLQPA

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
16 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
26 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
32 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
33 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
34 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
35 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
36 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
49 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
55 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
56 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
57 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
58 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
59 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
62 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
63 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
64 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
65 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
66 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
67 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
68 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.24
Nodule 0
Rhizoplane 0
Rhizosphere 62.2
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10005919 3300021377 Bacteria 2870
2 Ga0070683_100274469 3300005329 Bacteria 1604
3 Ga0070674_100042875 3300005356 Bacteria 3076
4 Ga0070714_100072082 3300005435 Bacteria 2990
5 Ga0070710_10168594 3300005437 Bacteria 1363
6 Ga0070678_100346978 3300005456 Bacteria 1275
7 Ga0068860_100010842 3300005843 Bacteria 8995
8 Ga0081538_10113919 3300005981 Bacteria 1319
9 Ga0075365_10005802 3300006038 Bacteria 6705
10 Ga0075365_10064394 3300006038 Bacteria 2456
11 Ga0075363_100017750 3300006048 Bacteria 3534
12 Ga0075364_10035383 3300006051 Bacteria 3227
13 Ga0075364_10041788 3300006051 Bacteria 2978
14 Ga0075364_10229485 3300006051 Bacteria 1261
15 Ga0075364_10357968 3300006051 Bacteria 995
16 Ga0075362_10037352 3300006177 Bacteria 2129
17 Ga0075369_10105482 3300006186 Bacteria 1267
18 Ga0111539_10762295 3300009094 Bacteria 1126
19 Ga0111539_10777894 3300009094 Bacteria 1114
20 Ga0157379_10006320 3300014968 Bacteria 10202
21 Ga0213873_10038670 3300021358 Unclassified 1220
22 Ga0213874_10000166 3300021377 Bacteria 11761
23 Ga0213874_10030756 3300021377 Bacteria 1549
24 Ga0213876_10013051 3300021384 Bacteria 4416
25 Ga0213876_10013998 3300021384 Bacteria 4252
26 Ga0213876_10021199 3300021384 Bacteria 3436
27 Ga0213876_10064999 3300021384 Bacteria 1925
28 Ga0213876_10088711 3300021384 Bacteria 1638
29 Ga0213875_10005155 3300021388 Bacteria 7070
30 Ga0213875_10005634 3300021388 Bacteria 6684
31 Ga0213875_10015370 3300021388 Bacteria 3725
32 Ga0213875_10029452 3300021388 Bacteria 2604
33 Ga0213875_10035525 3300021388 Bacteria 2351
34 Ga0207692_10071502 3300025898 Bacteria 1830
35 Ga0207693_10211974 3300025915 Bacteria 1522
36 Ga0207649_10306823 3300025920 Bacteria 1162
37 Ga0207664_10132866 3300025929 Bacteria 2097
38 Ga0207669_10021231 3300025937 Bacteria 3424
39 Ga0207708_10050073 3300026075 Bacteria 3180
40 Ga0207428_10436166 3300027907 Bacteria 956
41 Ga0268264_10009841 3300028381 Bacteria 7914
42 Ga0307413_10468925 3300031824 Bacteria 1004
43 Ga0395898_0485019 3300037466 Bacteria 1176
44 Ga0436364_0045049 3300037853 Bacteria 87133
45 Ga0436364_0297368 3300037853 Bacteria 7725
46 Ga0436364_0322517 3300037853 Bacteria 14825
47 Ga0436364_0484050 3300037853 Bacteria 4224
48 Ga0436364_0996326 3300037853 Bacteria 14061
49 Ga0436364_1257906 3300037853 Bacteria 1444
50 Ga0436364_1307616 3300037853 Unclassified 1537
51 Ga0436364_1416692 3300037853 Bacteria 8490
52 Ga0395901_0198180 3300038443 Bacteria 2105
53 Ga0436365_0150830 3300039437 Bacteria 8782
54 Ga0436365_0209010 3300039437 Bacteria 25435
55 Ga0436365_0435824 3300039437 Bacteria 1576
56 Ga0436365_0707563 3300039437 Bacteria 4916
57 Ga0436365_0720354 3300039437 Bacteria 7404
58 Ga0436365_0864689 3300039437 Bacteria 8477
59 Ga0436365_1223411 3300039437 Bacteria 2142
60 Ga0436365_1630007 3300039437 Unclassified 3451
61 Ga0436365_1720874 3300039437 Bacteria 5305
62 Ga0436365_1862522 3300039437 Bacteria 15261
63 Ga0436363_0152755 3300039450 Bacteria 5591
64 Ga0436363_0198760 3300039450 Bacteria 34031
65 Ga0436363_0402201 3300039450 Bacteria 1472
66 Ga0436363_0436702 3300039450 Bacteria 8639
67 Ga0436362_0581738 3300039453 Bacteria 5528
68 Ga0439448_0079734 3300042005 Bacteria 1098
69 Ga0466969_0094708 3300044656 Bacteria 1411
70 Ga0466965_0136678 3300044683 Bacteria 1274
71 Ga0466965_0158263 3300044683 Bacteria 1187
72 Ga0466965_0183962 3300044683 Bacteria 1103
73 Ga0466966_0114634 3300044684 Unclassified 1660
74 Ga0466961_0006922 3300044693 Bacteria 7213
75 Ga0466961_0071392 3300044693 Bacteria 2203
76 Ga0466963_0001804 3300044694 Bacteria 11656
77 Ga0466963_0003956 3300044694 Bacteria 8573
78 Ga0466963_0015306 3300044694 Bacteria 4746
79 Ga0466963_0100283 3300044694 Bacteria 1981
80 Ga0466963_0195819 3300044694 Unclassified 1413
81 Ga0466971_0014691 3300044719 Bacteria 3446
82 Ga0466971_0038790 3300044719 Bacteria 2138
83 Ga0466968_0012091 3300044735 Bacteria 3372
84 Ga0466968_0103904 3300044735 Bacteria 1271
85 Ga0466970_0006878 3300044765 Bacteria 5695
86 Ga0466957_0042168 3300044842 Bacteria 2760
87 Ga0466960_0000263 3300044901 Bacteria 18091
88 Ga0466959_0004083 3300045049 Bacteria 9714
89 Ga0466959_0072000 3300045049 Bacteria 2502
90 Ga0466959_0138128 3300045049 Unclassified 1724
91 Ga0466959_0150402 3300045049 Bacteria 1641
92 Ga0466959_0207310 3300045049 Bacteria 1363
93 Ga0466958_0001376 3300045836 Bacteria 11489
94 Ga0466958_0005686 3300045836 Bacteria 6735
95 Ga0466958_0013603 3300045836 Bacteria 4636
96 Ga0466958_0025339 3300045836 Bacteria 3497
97 Ga0466958_0046974 3300045836 Bacteria 2606
98 Ga0466958_0060004 3300045836 Unclassified 2315
99 Ga0466958_0079446 3300045836 Bacteria 2017
100 Ga0466958_0242635 3300045836 Bacteria 1151
101 Ga0466958_0247653 3300045836 Bacteria 1139
102 Ga0466967_0249838 3300045976 Bacteria 1694
103 Ga0466967_0346777 3300045976 Unclassified 1437
104 Ga0495672_0004605 3300047320 Bacteria 11203
105 Ga0501031_0109338 3300049568 Bacteria 1805
106 Ga0501032_0154005 3300049569 Bacteria 1511
107 Ga0501039_0072341 3300049575 Bacteria 2679
108 Ga0501041_0125626 3300049577 Bacteria 1596
109 Ga0501048_0103242 3300049582 Bacteria 2012
110 Ga0501071_0021129 3300049587 Bacteria 4533
111 Ga0501071_0059756 3300049587 Bacteria 2759
112 Ga0501072_0028013 3300049588 Bacteria 4398
113 Ga0501075_0077294 3300049591 Bacteria 2519
114 Ga0501076_0055999 3300049592 Bacteria 3128
115 Ga0501077_0004346 3300049593 Bacteria 8594
116 Ga0501079_0011707 3300049741 Bacteria 6699
117 Ga0501081_0088420 3300049743 Bacteria 2176
118 nmdc:mga03683_43239_c1 3300050489 Bacteria 1858
119 nmdc:mga00v17_73459_c1 3300050491 Bacteria 2124
120 nmdc:mga00v17_76220_c1 3300050491 Bacteria 2086
121 nmdc:mga06z11_246006_c1 3300050494 Bacteria 1052
122 nmdc:mga08y16_290388_c1 3300050511 Bacteria 1686
123 Ga0501084_0070446 3300054114 Bacteria 2928
124 Ga0501084_0099390 3300054114 Bacteria 2443
125 Ga0501082_0070215 3300060353 Bacteria 3016
126 Ga0466962_0014392 3300061719 Bacteria 3811
127 Ga0530510_0009760 3300061734 Bacteria 6735
128 Ga0213874_10005919
129 Ga0070683_100274469
130 Ga0070674_100042875
131 Ga0070714_100072082
132 Ga0070710_10168594
133 Ga0070678_100346978
134 Ga0068860_100010842
135 Ga0081538_10113919
136 Ga0075365_10005802
137 Ga0075365_10064394
138 Ga0075363_100017750
139 Ga0075364_10035383
140 Ga0075364_10041788
141 Ga0075364_10229485
142 Ga0075364_10357968
143 Ga0075362_10037352
144 Ga0075369_10105482
145 Ga0111539_10762295
146 Ga0111539_10777894
147 Ga0157379_10006320
148 Ga0213873_10038670
149 Ga0213874_10000166
150 Ga0213874_10030756
151 Ga0213876_10013051
152 Ga0213876_10013998
153 Ga0213876_10021199
154 Ga0213876_10064999
155 Ga0213876_10088711
156 Ga0213875_10005155
157 Ga0213875_10005634
158 Ga0213875_10015370
159 Ga0213875_10029452
160 Ga0213875_10035525
161 Ga0207692_10071502
162 Ga0207693_10211974
163 Ga0207649_10306823
164 Ga0207664_10132866
165 Ga0207669_10021231
166 Ga0207708_10050073
167 Ga0207428_10436166
168 Ga0268264_10009841
169 Ga0307413_10468925
170 Ga0395898_0485019
171 Ga0436364_0045049
172 Ga0436364_0297368
173 Ga0436364_0322517
174 Ga0436364_0484050
175 Ga0436364_0996326
176 Ga0436364_1257906
177 Ga0436364_1307616
178 Ga0436364_1416692
179 Ga0395901_0198180
180 Ga0436365_0150830
181 Ga0436365_0209010
182 Ga0436365_0435824
183 Ga0436365_0707563
184 Ga0436365_0720354
185 Ga0436365_0864689
186 Ga0436365_1223411
187 Ga0436365_1630007
188 Ga0436365_1720874
189 Ga0436365_1862522
190 Ga0436363_0152755
191 Ga0436363_0198760
192 Ga0436363_0402201
193 Ga0436363_0436702
194 Ga0436362_0581738
195 Ga0439448_0079734
196 Ga0466969_0094708
197 Ga0466965_0136678
198 Ga0466965_0158263
199 Ga0466965_0183962
200 Ga0466966_0114634
201 Ga0466961_0006922
202 Ga0466961_0071392
203 Ga0466963_0001804
204 Ga0466963_0003956
205 Ga0466963_0015306
206 Ga0466963_0100283
207 Ga0466963_0195819
208 Ga0466971_0014691
209 Ga0466971_0038790
210 Ga0466968_0012091
211 Ga0466968_0103904
212 Ga0466970_0006878
213 Ga0466957_0042168
214 Ga0466960_0000263
215 Ga0466959_0004083
216 Ga0466959_0072000
217 Ga0466959_0138128
218 Ga0466959_0150402
219 Ga0466959_0207310
220 Ga0466958_0001376
221 Ga0466958_0005686
222 Ga0466958_0013603
223 Ga0466958_0025339
224 Ga0466958_0046974
225 Ga0466958_0060004
226 Ga0466958_0079446
227 Ga0466958_0242635
228 Ga0466958_0247653
229 Ga0466967_0249838
230 Ga0466967_0346777
231 Ga0495672_0004605
232 Ga0501031_0109338
233 Ga0501032_0154005
234 Ga0501039_0072341
235 Ga0501041_0125626
236 Ga0501048_0103242
237 Ga0501071_0021129
238 Ga0501071_0059756
239 Ga0501072_0028013
240 Ga0501075_0077294
241 Ga0501076_0055999
242 Ga0501077_0004346
243 Ga0501079_0011707
244 Ga0501081_0088420
245 nmdc:mga03683_43239_c1
246 nmdc:mga00v17_73459_c1
247 nmdc:mga00v17_76220_c1
248 nmdc:mga06z11_246006_c1
249 nmdc:mga08y16_290388_c1
250 Ga0501084_0070446
251 Ga0501084_0099390
252 Ga0501082_0070215
253 Ga0466962_0014392
254 Ga0530510_0009760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

213

300

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

213

311

0.9

PF09990

DUF2231

Predicted membrane protein (DUF2231)

75

204

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9652 190 289
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9569 192 289
2i7f-assembly2.cif.gz_B sphingomonas yanoikuyae b1 ferredoxin 0.9341 191 289
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9321 191 293
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.9299 191 290
ID Description Score Start End Superfamily
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9621 193 288 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9569 192 289 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9432 192 288 2.102.10.10
af_Q9VJ03_9_118_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9385 193 291 2.102.10.10
2i7fB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9341 191 289 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A0N1BY45-F1-model_v4 Rieske domain-containing protein 0.9751 191 289 GO:0046872
GO:0051537
AF-A0A3N5FKH2-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9736 191 288 GO:0046872
GO:0051537
AF-A0A6A7LL11-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9727 193 288 GO:0046872
GO:0051537
AF-A0A5N9AG50-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9725 207 288 GO:0016020
GO:0046872
GO:0051537
AF-A0A7J4L9F8-F1-model_v4 Rieske (2Fe-2S) protein 0.9722 194 288 GO:0046872
GO:0051537

Map