F132434

General Info

Members Datasets Scaffolds Average Seq Length
126 105 252 300

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939598168|2939599234
Length 337
Sequence MFRCAKVAARTSARGTAGLRAAGAAAVVVLSFALAACGGNASGNGDSGKKVVLTTFTVLADVARNVAGDKLTVESITKAGAEIHGYEPTPGDIRKASKADLILDNGLNLEAWFAQFVEGLDVPHAVVSDGVEVMSISEDSYQGKPNPHAWMSPVNVQIYVDNMVKAFAELDPENAEAFRANGDAYKAKLQAVQDEMKASLAGVPEKQRALVTCEGAFSYLARDAGLREVYIWAVNAEQQATPQQITRAIEYVKANQVPAVFCESTVSDAPMQQVVGATGTKFGGTLYVDSLSEADGPVPTYLDLIRHDAGLITKSLTGATTGATTGAAAGASAGAKP

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
4 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
5 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
16 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
17 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
20 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
21 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
22 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
23 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
26 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
27 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
28 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
29 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
30 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
31 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
32 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
33 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
36 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
37 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
38 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
39 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
42 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
43 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
44 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
45 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
46 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
47 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
48 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
53 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
54 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
55 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
56 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
57 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
58 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
59 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
60 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
61 2643221546 Microbacterium sp. Root53 Isolate Unclassified
62 2643221692 Nocardia sp. Root136 Isolate Unclassified
63 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
64 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
65 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
66 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
67 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
68 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
69 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
70 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
71 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
72 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
73 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
74 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
75 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
76 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
77 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
78 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
79 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
80 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
81 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
82 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
83 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
84 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
85 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
86 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
87 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
88 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
89 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
90 2919395869 Microbacterium resistens 2980 Isolate Unclassified
91 2922554459 Rhodococcus sp. 66b Isolate Unclassified
92 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
93 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
94 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
95 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
96 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
97 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
98 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
99 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
100 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
101 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
102 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
103 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
104 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
105 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 61.11
Metatranscriptomes 0
Isolates 38.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.79
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 1.59
Rhizosphere 67.46
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10075656 3300005333 Bacteria 1428
2 Ga0070667_100065890 3300005367 Bacteria 3076
3 Ga0075364_10100117 3300006051 Bacteria 1929
4 Ga0075432_10014368 3300006058 Bacteria 2697
5 Ga0075370_10055855 3300006353 Bacteria 2243
6 Ga0105244_10025948 3300009036 Bacteria 3176
7 Ga0105243_10008579 3300009148 Bacteria 7841
8 Ga0105246_10088334 3300011119 Bacteria 2227
9 Ga0207697_10006023 3300025315 Bacteria 5548
10 Ga0207655_1043317 3300025728 Bacteria 1904
11 Ga0207682_10129223 3300025893 Bacteria 1127
12 Ga0207688_10188139 3300025901 Bacteria 1234
13 Ga0207709_10006856 3300025935 Bacteria 6376
14 Ga0207658_10056317 3300025986 Bacteria 2917
15 Ga0307513_10015160 3300031456 Bacteria 9355
16 Ga0307408_100016464 3300031548 Bacteria 4936
17 Ga0307408_100058008 3300031548 Bacteria 2813
18 Ga0307408_100202005 3300031548 Bacteria 1609
19 Ga0307408_100286203 3300031548 Bacteria 1374
20 Ga0307405_10025555 3300031731 Bacteria 3393
21 Ga0307405_10141058 3300031731 Bacteria 1680
22 Ga0307413_10045423 3300031824 Bacteria 2604
23 Ga0307413_10071603 3300031824 Bacteria 2185
24 Ga0307518_10000601 3300031838 Bacteria 27469
25 Ga0307410_10014414 3300031852 Bacteria 4650
26 Ga0307410_10149733 3300031852 Bacteria 1736
27 Ga0307410_10224599 3300031852 Bacteria 1446
28 Ga0307407_10218258 3300031903 Bacteria 1288
29 Ga0307412_10033666 3300031911 Bacteria 3259
30 Ga0307412_10210489 3300031911 Bacteria 1483
31 Ga0307409_100043947 3300031995 Bacteria 3360
32 Ga0307409_100106803 3300031995 Bacteria 2337
33 Ga0307416_100008121 3300032002 Bacteria 6740
34 Ga0307416_100087200 3300032002 Bacteria 2664
35 Ga0307415_100073412 3300032126 Bacteria 2414
36 Ga0439436_0003053 3300041404 Bacteria 5080
37 Ga0439466_0023557 3300041411 Bacteria 2164
38 Ga0439465_0054967 3300041413 Bacteria 1310
39 Ga0439431_0007908 3300041997 Bacteria 2378
40 Ga0439433_0003919 3300041999 Bacteria 3201
41 Ga0439442_000080 3300042002 Bacteria 22848
42 Ga0439442_000742 3300042002 Bacteria 6832
43 Ga0439442_009222 3300042002 Bacteria 1995
44 Ga0439442_019602 3300042002 Bacteria 1400
45 Ga0439445_0007813 3300042004 Bacteria 2491
46 Ga0439432_057745 3300042006 Bacteria 1201
47 Ga0439449_0001848 3300042007 Bacteria 8329
48 Ga0439449_0046955 3300042007 Bacteria 1599
49 Ga0439452_006763 3300042010 Bacteria 3566
50 Ga0439462_0030913 3300042015 Bacteria 1417
51 Ga0450907_002246 3300042146 Bacteria 3757
52 Ga0450907_003278 3300042146 Bacteria 2914
53 Ga0439434_0000794 3300042435 Bacteria 9103
54 Ga0439434_0008794 3300042435 Bacteria 2966
55 Ga0450918_001333 3300042531 Bacteria 4961
56 Ga0450918_002049 3300042531 Bacteria 3857
57 Ga0453684_0202678 3300044712 Unclassified 2312
58 Ga0495668_0001949 3300046616 Bacteria 18318
59 Ga0496102_0316425 3300048905 Bacteria 1470
60 Ga0496108_0606378 3300048911 Bacteria 954
61 Ga0496117_0033549 3300048920 Bacteria 3879
62 Ga0496118_0059350 3300048921 Bacteria 2849
63 Ga0496118_0110441 3300048921 Bacteria 1826
64 Ga0496122_0000515 3300048925 Bacteria 79995
65 Ga0496125_0000046 3300048928 Bacteria 295288
66 Ga0496125_0016368 3300048928 Bacteria 7125
67 Ga0496125_0180144 3300048928 Bacteria 1409
68 Ga0501034_0000042 3300049571 Bacteria 229124
69 Ga0501034_0015053 3300049571 Bacteria 7953
70 Ga0501038_0099007 3300049574 Bacteria 2431
71 Ga0501039_0037337 3300049575 Bacteria 3749
72 Ga0501043_0456945 3300049579 Bacteria 959
73 Ga0501075_0180817 3300049591 Bacteria 1609
74 Ga0501076_0475631 3300049592 Bacteria 1029
75 Ga0501045_0502559 3300049824 Bacteria 900
76 nmdc:mga06z11_289106_c1 3300050494 Bacteria 972
77 nmdc:mga07m45_114342_c1 3300050496 Bacteria 1556
78 2939599234 2939598168 Bacteria 4687164
79 2555230855 2554235227 Bacteria 3637389
80 2566992954 2565956761 Bacteria 6601618
81 2586063843 2585427649 Bacteria 9053857
82 2643751820 2643221546 Bacteria 2910897
83 2644517127 2643221692 Bacteria 7282860
84 2655033720 2654587600 Bacteria 3911798
85 2691515190 2690315906 Bacteria 4517044
86 2738694591 2738541272 Bacteria 6848551
87 2738891797 2738541308 Bacteria 7020677
88 2739326010 2738543027 Bacteria 6409078
89 2739362120 2738543034 Bacteria 6084756
90 2753036029 2751185725 Bacteria 5740550
91 2753323901 2751185792 Bacteria 5739090
92 2760307555 2758568522 Bacteria 5953541
93 2760623849 2758568621 Bacteria 5967089
94 2808892601 2808606370 Bacteria 4942454
95 2809225605 2808606447 Bacteria 3572005
96 2809586909 2808606522 Bacteria 9488490
97 2810364161 2808606700 Bacteria 3482157
98 2844850028 2844849076 Bacteria 4091819
99 2852635547 2852632344 Bacteria 3463163
100 2852649141 2852646457 Bacteria 3408613
101 2852680683 2852677369 Bacteria 3768884
102 2857722780 2857720070 Bacteria 3189373
103 2857742327 2857740372 Bacteria 4782044
104 2866616205 2866612099 Bacteria 7543886
105 2904536468 2904535858 Bacteria 6308016
106 2905929130 2905926851 Bacteria 4423176
107 2906801641 2906799679 Bacteria 4031749
108 2910814604 2910809715 Bacteria 4982797
109 2915772150 2915768154 Bacteria 8424322
110 2919059223 2919059106 Bacteria 4991624
111 2919396359 2919395869 Bacteria 3704152
112 2922558405 2922554459 Bacteria 6683962
113 2928093869 2928090899 Bacteria 3158267
114 2932427316 2932426870 Bacteria 4547726
115 2933420920 2933418574 Bacteria 4476724
116 2939650461 2939647034 Bacteria 4681660
117 2939676833 2939674588 Bacteria 4844420
118 2945969565 2945968032 Bacteria 4111363
119 2953998953 2953998280 Bacteria 4812144
120 2984582446 2984580707 Bacteria 3351387
121 2995728172 2995726249 Bacteria 3470435
122 8004214979 8004212874 Bacteria 2861420
123 8046354299 8046352972 Bacteria 3613806
124 8054110890 8054107350 Bacteria 5022511
125 8055035805 8055034563 Bacteria 3562128
126 8056582501 8056579771 Bacteria 5840325
127 Ga0070677_10075656
128 Ga0070667_100065890
129 Ga0075364_10100117
130 Ga0075432_10014368
131 Ga0075370_10055855
132 Ga0105244_10025948
133 Ga0105243_10008579
134 Ga0105246_10088334
135 Ga0207697_10006023
136 Ga0207655_1043317
137 Ga0207682_10129223
138 Ga0207688_10188139
139 Ga0207709_10006856
140 Ga0207658_10056317
141 Ga0307513_10015160
142 Ga0307408_100016464
143 Ga0307408_100058008
144 Ga0307408_100202005
145 Ga0307408_100286203
146 Ga0307405_10025555
147 Ga0307405_10141058
148 Ga0307413_10045423
149 Ga0307413_10071603
150 Ga0307518_10000601
151 Ga0307410_10014414
152 Ga0307410_10149733
153 Ga0307410_10224599
154 Ga0307407_10218258
155 Ga0307412_10033666
156 Ga0307412_10210489
157 Ga0307409_100043947
158 Ga0307409_100106803
159 Ga0307416_100008121
160 Ga0307416_100087200
161 Ga0307415_100073412
162 Ga0439436_0003053
163 Ga0439466_0023557
164 Ga0439465_0054967
165 Ga0439431_0007908
166 Ga0439433_0003919
167 Ga0439442_000080
168 Ga0439442_000742
169 Ga0439442_009222
170 Ga0439442_019602
171 Ga0439445_0007813
172 Ga0439432_057745
173 Ga0439449_0001848
174 Ga0439449_0046955
175 Ga0439452_006763
176 Ga0439462_0030913
177 Ga0450907_002246
178 Ga0450907_003278
179 Ga0439434_0000794
180 Ga0439434_0008794
181 Ga0450918_001333
182 Ga0450918_002049
183 Ga0453684_0202678
184 Ga0495668_0001949
185 Ga0496102_0316425
186 Ga0496108_0606378
187 Ga0496117_0033549
188 Ga0496118_0059350
189 Ga0496118_0110441
190 Ga0496122_0000515
191 Ga0496125_0000046
192 Ga0496125_0016368
193 Ga0496125_0180144
194 Ga0501034_0000042
195 Ga0501034_0015053
196 Ga0501038_0099007
197 Ga0501039_0037337
198 Ga0501043_0456945
199 Ga0501075_0180817
200 Ga0501076_0475631
201 Ga0501045_0502559
202 nmdc:mga06z11_289106_c1
203 nmdc:mga07m45_114342_c1
204 2939599234
205 2555230855
206 2566992954
207 2586063843
208 2643751820
209 2644517127
210 2655033720
211 2691515190
212 2738694591
213 2738891797
214 2739326010
215 2739362120
216 2753036029
217 2753323901
218 2760307555
219 2760623849
220 2808892601
221 2809225605
222 2809586909
223 2810364161
224 2844850028
225 2852635547
226 2852649141
227 2852680683
228 2857722780
229 2857742327
230 2866616205
231 2904536468
232 2905929130
233 2906801641
234 2910814604
235 2915772150
236 2919059223
237 2919396359
238 2922558405
239 2928093869
240 2932427316
241 2933420920
242 2939650461
243 2939676833
244 2945969565
245 2953998953
246 2984582446
247 2995728172
248 8004214979
249 8046354299
250 8054110890
251 8055035805
252 8056582501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

52

315

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hx7-assembly1.cif.gz_A metal abc transporter from listeria monocytogenes 0.9503 34 299
3zk9-assembly2.cif.gz_B crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state 0.9435 34 299
6ixi-assembly1.cif.gz_A structure of cd-bound periplasmic metal binding protein from candidatus liberibacter asiaticus 0.9381 31 298
4cl2-assembly1.cif.gz_A structure of periplasmic metal binding protein from candidatus liberibacter asiaticus 0.9379 31 298
5zha-assembly1.cif.gz_A structure of y68f mutant mn-bound periplasmic metal binding protein from candidatus liberibacter asiaticus 0.9362 31 298
ID Description Score Start End Superfamily
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9549 33 182 3.40.50.1980
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9549 33 182 3.40.50.1980
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9362 33 182 3.40.50.1980
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9358 33 182 3.40.50.1980
5afsA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9356 184 296 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2J7KH67-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9705 192 302 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A0F9MK57-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9634 143 300 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A484X029-F1-model_v4 Periplasmic solute binding protein 0.9549 134 285 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A826U0N3-F1-model_v4 deleted 0.9544 154 302
AF-A0A3S5ES28-F1-model_v4 Periplasmic iron-binding protein 0.9503 24 172 GO:0007155
GO:0030001
GO:0030313
GO:0046872

Map