F131382

General Info

Members Datasets Scaffolds Average Seq Length
126 92 126 264

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0095088|Ga0451577_0095088_1223_2179
Length 318
Sequence VQPYELVFDGLWEKCQYNSCIKFQNLPKCFTKCSSSGLDQPLTPFGLLLEGSTMQAEERQHRIGEYLQEVEFASLEEIARQVDASVSTVRRDLTILETSGGIRRTHGGARIVVPKSDEFAFSARDTHQLAEKEAIGRACADLIGFHQSIIIDAGTTAYHVARYLESKAPQIITNSLPVANLFASANRIEVIVSGGVIYPRLGVLVGPLAVEAFRKIHVDVAIMSAGGLSLEGISNSHGLLIDIQRAMIQAARRVIFCLDHTKLGRQSILPLCDLNSVHTLVSDQGAPAELVQALRDRGMEVVLAPGATGTGTPQPNGQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
56 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
57 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
58 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
59 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
60 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
61 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10115922 3300003320 Unclassified 4390
2 rootH1_10108249 3300003323 Bacteria 3699
3 Ga0065707_10236167 3300005295 Unclassified 1171
4 Ga0070658_10537349 3300005327 Bacteria 1011
5 Ga0070689_100096030 3300005340 Bacteria 2342
6 Ga0070675_100149593 3300005354 Bacteria 2001
7 Ga0070688_100049913 3300005365 Bacteria 2605
8 Ga0070714_100030884 3300005435 Bacteria 4464
9 Ga0070705_100108074 3300005440 Bacteria 1771
10 Ga0070694_100038339 3300005444 Bacteria 3184
11 Ga0070678_100163866 3300005456 Bacteria 1804
12 Ga0070678_100286408 3300005456 Bacteria 1395
13 Ga0070681_10145125 3300005458 Unclassified 2302
14 Ga0070685_10215856 3300005466 Unclassified 1254
15 Ga0070686_100003979 3300005544 Bacteria 8127
16 Ga0070686_100519206 3300005544 Bacteria 927
17 Ga0068855_100053461 3300005563 Unclassified 4751
18 Ga0068855_100536926 3300005563 Unclassified 1267
19 Ga0068857_100001400 3300005577 Bacteria 19042
20 Ga0068856_100007084 3300005614 Bacteria 10948
21 Ga0068859_100046268 3300005617 Bacteria 4370
22 Ga0068859_100367713 3300005617 Bacteria 1533
23 Ga0068863_100015459 3300005841 Bacteria 7337
24 Ga0068871_100160746 3300006358 Bacteria 1921
25 Ga0075429_100141904 3300006880 Unclassified 2103
26 Ga0097620_100046268 3300006931 Bacteria 4370
27 Ga0097620_100367745 3300006931 Bacteria 1533
28 Ga0097620_100394750 3300006931 Unclassified 1479
29 Ga0105240_10007881 3300009093 Bacteria 15357
30 Ga0105240_10058387 3300009093 Bacteria 4817
31 Ga0105240_10459447 3300009093 Unclassified 1423
32 Ga0105240_10500219 3300009093 Bacteria 1352
33 Ga0105240_10526197 3300009093 Unclassified 1311
34 Ga0105242_10538084 3300009176 Bacteria 1118
35 Ga0105237_10285075 3300009545 Bacteria 1654
36 Ga0105238_10017297 3300009551 Bacteria 7326
37 Ga0105238_10058521 3300009551 Unclassified 3862
38 Ga0105249_10058921 3300009553 Bacteria 3521
39 Ga0105239_10800371 3300010375 Unclassified 1080
40 Ga0157374_10269414 3300013296 Bacteria 1679
41 Ga0157374_10370476 3300013296 Unclassified 1425
42 Ga0157375_10000068 3300013308 Bacteria 110172
43 Ga0163163_10000091 3300014325 Bacteria 96507
44 Ga0157380_10793338 3300014326 Unclassified 963
45 Ga0157379_10200840 3300014968 Unclassified 1803
46 Ga0207680_10026111 3300025903 Unclassified 3233
47 Ga0207694_10015847 3300025924 Bacteria 5686
48 Ga0207664_10010320 3300025929 Bacteria 6596
49 Ga0207670_10648334 3300025936 Unclassified 870
50 Ga0207667_10020721 3300025949 Bacteria 7305
51 Ga0207667_10834185 3300025949 Unclassified 917
52 Ga0207640_10142030 3300025981 Bacteria 1752
53 Ga0207639_10148683 3300026041 Unclassified 1960
54 Ga0207708_10344134 3300026075 Unclassified 1222
55 Ga0207702_10001457 3300026078 Bacteria 23515
56 Ga0207641_10081689 3300026088 Bacteria 2807
57 Ga0207674_10012252 3300026116 Bacteria 9590
58 Ga0207674_10138883 3300026116 Unclassified 2391
59 Ga0265323_10000048 3300028653 Bacteria 65493
60 Ga0265323_10000224 3300028653 Bacteria 33270
61 Ga0265322_10000168 3300028654 Bacteria 30155
62 Ga0265322_10000276 3300028654 Bacteria 21779
63 Ga0265338_10002771 3300028800 Bacteria 25646
64 Ga0265338_10034394 3300028800 Bacteria 4899
65 Ga0265338_10153436 3300028800 Unclassified 1787
66 Ga0265338_10379432 3300028800 Bacteria 1011
67 Ga0265324_10003048 3300029957 Bacteria 8184
68 Ga0265324_10004359 3300029957 Bacteria 6431
69 Ga0265324_10014175 3300029957 Bacteria 2956
70 Ga0265324_10015157 3300029957 Unclassified 2839
71 Ga0265324_10016477 3300029957 Bacteria 2697
72 Ga0265325_10012556 3300031241 Bacteria 4841
73 Ga0265329_10000980 3300031242 Bacteria 14278
74 Ga0265327_10070039 3300031251 Bacteria 1758
75 Ga0265316_10006499 3300031344 Bacteria 11157
76 Ga0265316_10013045 3300031344 Bacteria 7412
77 Ga0265314_10000142 3300031711 Bacteria 108299
78 Ga0265314_10038871 3300031711 Bacteria 3434
79 Ga0265342_10003957 3300031712 Bacteria 11871
80 Ga0265342_10018424 3300031712 Bacteria 4522
81 Ga0373930_0000054 3300034816 Bacteria 10635
82 Ga0373948_0031921 3300034817 Bacteria 1066
83 Ga0373950_0001292 3300034818 Bacteria 3242
84 Ga0373926_0064999 3300035083 Bacteria 1334
85 Ga0373928_0000275 3300035084 Bacteria 10133
86 Ga0373949_0001539 3300035090 Bacteria 6530
87 Ga0373932_0000006 3300035112 Bacteria 208547
88 Ga0373945_0015078 3300035116 Bacteria 2597
89 Ga0373943_0117812 3300035170 Bacteria 1408
90 Ga0373946_0029203 3300035171 Unclassified 2193
91 Ga0373962_0000299 3300035242 Bacteria 10680
92 Ga0373931_0000009 3300035691 Bacteria 349854
93 Ga0373935_0035685 3300035692 Bacteria 3104
94 Ga0373927_0006041 3300035695 Bacteria 8295
95 Ga0373927_0036395 3300035695 Bacteria 3201
96 Ga0373947_0005701 3300035725 Bacteria 7261
97 Ga0316584_0190796 3300036712 Bacteria 1515
98 Ga0373925_0001202 3300037068 Bacteria 22811
99 Ga0373925_0020562 3300037068 Bacteria 4807
100 Ga0373925_0395559 3300037068 Bacteria 1126
101 Ga0451577_0001129 3300042876 Bacteria 37856
102 Ga0451577_0043361 3300042876 Unclassified 4029
103 Ga0451577_0095088 3300042876 Unclassified 2661
104 Ga0453684_0001721 3300044712 Bacteria 58635
105 Ga0453684_0006457 3300044712 Bacteria 22262
106 Ga0451576_0400044 3300045051 Bacteria 1440
107 Ga0495580_0266517 3300046472 Bacteria 1171
108 Ga0495630_0156596 3300046517 Bacteria 1734
109 Ga0495666_0105043 3300046526 Bacteria 1329
110 Ga0495586_0000442 3300046535 Bacteria 24932
111 Ga0495586_0128905 3300046535 Bacteria 1416
112 Ga0495581_0235338 3300047315 Bacteria 1071
113 Ga0495604_0225860 3300047317 Bacteria 1287
114 Ga0495674_0000154 3300047319 Bacteria 53023
115 Ga0495676_0013584 3300047321 Bacteria 7312
116 Ga0496107_0136002 3300048910 Bacteria 1815
117 Ga0496115_0003749 3300048918 Bacteria 10930
118 Ga0501031_0000331 3300049568 Bacteria 27355
119 Ga0501033_0011186 3300049570 Bacteria 6874
120 Ga0501037_0075394 3300049573 Unclassified 2450
121 Ga0501039_0593539 3300049575 Bacteria 868
122 Ga0501047_0105955 3300049581 Unclassified 2692
123 Ga0501035_0001919 3300049822 Bacteria 20852
124 Ga0501044_0000207 3300049823 Bacteria 74769
125 nmdc:mga08y16_66678_c1 3300050511 Bacteria 3756
126 nmdc:mga08y16_824365_c1 3300050511 Unclassified 919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_66678_c1 nmdc:mga08y16_66678_c1_1030_1869 252
2 3300050511 nmdc:mga08y16_824365_c1 nmdc:mga08y16_824365_c1_16_864 253
3 3300005295 Ga0065707_10236167 Ga0065707_102361672 254
4 3300005365 Ga0070688_100049913 Ga0070688_1000499135 254
5 3300005444 Ga0070694_100038339 Ga0070694_1000383395 254
6 3300005544 Ga0070686_100003979 Ga0070686_1000039792 254
7 3300005617 Ga0068859_100046268 Ga0068859_1000462682 254
8 3300005617 Ga0068859_100367713 Ga0068859_1003677132 254
9 3300005841 Ga0068863_100015459 Ga0068863_1000154593 254
10 3300006358 Ga0068871_100160746 Ga0068871_1001607461 254
11 3300006880 Ga0075429_100141904 Ga0075429_1001419043 254
12 3300006931 Ga0097620_100046268 Ga0097620_1000462682 254
13 3300006931 Ga0097620_100367745 Ga0097620_1003677451 254
14 3300009176 Ga0105242_10538084 Ga0105242_105380841 254
15 3300009553 Ga0105249_10058921 Ga0105249_100589215 254
16 3300048910 Ga0496107_0136002 Ga0496107_0136002_894_1697 254
17 3300005327 Ga0070658_10537349 Ga0070658_105373491 256
18 3300005340 Ga0070689_100096030 Ga0070689_1000960302 256
19 3300005440 Ga0070705_100108074 Ga0070705_1001080742 256
20 3300005544 Ga0070686_100519206 Ga0070686_1005192061 256
21 3300009093 Ga0105240_10459447 Ga0105240_104594472 256
22 3300009551 Ga0105238_10017297 Ga0105238_100172972 256
23 3300013296 Ga0157374_10370476 Ga0157374_103704762 256
24 3300014326 Ga0157380_10793338 Ga0157380_107933381 256
25 3300025924 Ga0207694_10015847 Ga0207694_100158474 256
26 3300036712 Ga0316584_0190796 Ga0316584_0190796_150_923 257
27 3300046535 Ga0495586_0000442 Ga0495586_0000442_1570_2346 258
28 3300047315 Ga0495581_0235338 Ga0495581_0235338_218_994 258
29 3300047319 Ga0495674_0000154 Ga0495674_0000154_41058_41834 258
30 3300047321 Ga0495676_0013584 Ga0495676_0013584_4170_4946 258
31 3300003323 rootH1_10108249 rootH1_101082495 259
32 3300009093 Ga0105240_10058387 Ga0105240_100583876 259
33 3300042876 Ga0451577_0043361 Ga0451577_0043361_1499_2278 259
34 3300045051 Ga0451576_0400044 Ga0451576_0400044_616_1395 259
35 3300049568 Ga0501031_0000331 Ga0501031_0000331_21263_22042 259
36 3300049570 Ga0501033_0011186 Ga0501033_0011186_4220_4999 259
37 3300049822 Ga0501035_0001919 Ga0501035_0001919_743_1522 259
38 3300049823 Ga0501044_0000207 Ga0501044_0000207_524_1303 259
39 3300003320 rootH2_10115922 rootH2_101159223 260
40 3300005354 Ga0070675_100149593 Ga0070675_1001495931 260
41 3300005435 Ga0070714_100030884 Ga0070714_1000308845 260
42 3300005456 Ga0070678_100163866 Ga0070678_1001638662 260
43 3300005456 Ga0070678_100286408 Ga0070678_1002864081 260
44 3300005458 Ga0070681_10145125 Ga0070681_101451252 260
45 3300005466 Ga0070685_10215856 Ga0070685_102158561 260
46 3300005563 Ga0068855_100053461 Ga0068855_1000534612 260
47 3300005563 Ga0068855_100536926 Ga0068855_1005369262 260
48 3300005577 Ga0068857_100001400 Ga0068857_1000014002 260
49 3300005614 Ga0068856_100007084 Ga0068856_1000070845 260
50 3300006931 Ga0097620_100394750 Ga0097620_1003947502 260
51 3300009093 Ga0105240_10007881 Ga0105240_100078818 260
52 3300009093 Ga0105240_10500219 Ga0105240_105002193 260
53 3300009093 Ga0105240_10526197 Ga0105240_105261971 260
54 3300009545 Ga0105237_10285075 Ga0105237_102850752 260
55 3300009551 Ga0105238_10058521 Ga0105238_100585215 260
56 3300010375 Ga0105239_10800371 Ga0105239_108003711 260
57 3300013296 Ga0157374_10269414 Ga0157374_102694142 260
58 3300013308 Ga0157375_10000068 Ga0157375_1000006840 260
59 3300014325 Ga0163163_10000091 Ga0163163_1000009165 260
60 3300014968 Ga0157379_10200840 Ga0157379_102008402 260
61 3300025903 Ga0207680_10026111 Ga0207680_100261112 260
62 3300025929 Ga0207664_10010320 Ga0207664_100103205 260
63 3300025936 Ga0207670_10648334 Ga0207670_106483341 260
64 3300025949 Ga0207667_10020721 Ga0207667_100207215 260
65 3300025949 Ga0207667_10834185 Ga0207667_108341851 260
66 3300025981 Ga0207640_10142030 Ga0207640_101420301 260
67 3300026041 Ga0207639_10148683 Ga0207639_101486831 260
68 3300026075 Ga0207708_10344134 Ga0207708_103441342 260
69 3300026078 Ga0207702_10001457 Ga0207702_1000145717 260
70 3300026088 Ga0207641_10081689 Ga0207641_100816892 260
71 3300026116 Ga0207674_10012252 Ga0207674_1001225213 260
72 3300026116 Ga0207674_10138883 Ga0207674_101388832 260
73 3300028653 Ga0265323_10000048 Ga0265323_1000004851 260
74 3300028653 Ga0265323_10000224 Ga0265323_1000022411 260
75 3300028654 Ga0265322_10000168 Ga0265322_1000016813 260
76 3300028654 Ga0265322_10000276 Ga0265322_100002768 260
77 3300028800 Ga0265338_10002771 Ga0265338_1000277129 260
78 3300028800 Ga0265338_10034394 Ga0265338_100343942 260
79 3300028800 Ga0265338_10153436 Ga0265338_101534362 260
80 3300028800 Ga0265338_10379432 Ga0265338_103794322 260
81 3300029957 Ga0265324_10003048 Ga0265324_100030484 260
82 3300029957 Ga0265324_10004359 Ga0265324_100043593 260
83 3300029957 Ga0265324_10014175 Ga0265324_100141755 260
84 3300029957 Ga0265324_10015157 Ga0265324_100151572 260
85 3300029957 Ga0265324_10016477 Ga0265324_100164773 260
86 3300031241 Ga0265325_10012556 Ga0265325_100125564 260
87 3300031242 Ga0265329_10000980 Ga0265329_100009803 260
88 3300031251 Ga0265327_10070039 Ga0265327_100700392 260
89 3300031344 Ga0265316_10006499 Ga0265316_100064997 260
90 3300031344 Ga0265316_10013045 Ga0265316_100130458 260
91 3300031711 Ga0265314_10000142 Ga0265314_1000014267 260
92 3300031711 Ga0265314_10038871 Ga0265314_100388713 260
93 3300031712 Ga0265342_10003957 Ga0265342_1000395710 260
94 3300031712 Ga0265342_10018424 Ga0265342_100184242 260
95 3300034816 Ga0373930_0000054 Ga0373930_0000054_670_1467 260
96 3300034817 Ga0373948_0031921 Ga0373948_0031921_34_828 260
97 3300034818 Ga0373950_0001292 Ga0373950_0001292_1071_1868 260
98 3300035083 Ga0373926_0064999 Ga0373926_0064999_156_938 260
99 3300035084 Ga0373928_0000275 Ga0373928_0000275_2979_3776 260
100 3300035090 Ga0373949_0001539 Ga0373949_0001539_535_1332 260
101 3300035112 Ga0373932_0000006 Ga0373932_0000006_22796_23593 260
102 3300035116 Ga0373945_0015078 Ga0373945_0015078_689_1486 260
103 3300035170 Ga0373943_0117812 Ga0373943_0117812_379_1176 260
104 3300035171 Ga0373946_0029203 Ga0373946_0029203_204_1004 260
105 3300035242 Ga0373962_0000299 Ga0373962_0000299_3015_3812 260
106 3300035691 Ga0373931_0000009 Ga0373931_0000009_21111_21908 260
107 3300035692 Ga0373935_0035685 Ga0373935_0035685_833_1633 260
108 3300035695 Ga0373927_0006041 Ga0373927_0006041_2471_3271 260
109 3300035695 Ga0373927_0036395 Ga0373927_0036395_1020_1817 260
110 3300035725 Ga0373947_0005701 Ga0373947_0005701_705_1505 260
111 3300037068 Ga0373925_0001202 Ga0373925_0001202_18993_19790 260
112 3300037068 Ga0373925_0020562 Ga0373925_0020562_3991_4779 260
113 3300037068 Ga0373925_0395559 Ga0373925_0395559_277_1077 260
114 3300042876 Ga0451577_0001129 Ga0451577_0001129_18862_19647 260
115 3300042876 Ga0451577_0095088 Ga0451577_0095088_1223_2179 260
116 3300044712 Ga0453684_0001721 Ga0453684_0001721_15563_16348 260
117 3300044712 Ga0453684_0006457 Ga0453684_0006457_10708_11664 260
118 3300046472 Ga0495580_0266517 Ga0495580_0266517_129_920 260
119 3300046517 Ga0495630_0156596 Ga0495630_0156596_122_922 260
120 3300046526 Ga0495666_0105043 Ga0495666_0105043_409_1209 260
121 3300046535 Ga0495586_0128905 Ga0495586_0128905_386_1258 260
122 3300047317 Ga0495604_0225860 Ga0495604_0225860_118_969 260
123 3300048918 Ga0496115_0003749 Ga0496115_0003749_4019_4807 260
124 3300049573 Ga0501037_0075394 Ga0501037_0075394_47_835 260
125 3300049575 Ga0501039_0593539 Ga0501039_0593539_42_830 260
126 3300049581 Ga0501047_0105955 Ga0501047_0105955_1502_2284 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00455

DeoRC

DeoR C terminal sensor domain

127

284

0.98

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

59

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlz-assembly2.cif.gz_C crystal structure of transcription factor pf0095 from pyrococcus furiosus 0.913 10 58
7l6l-assembly1.cif.gz_E crystal structure of the dna-binding transcriptional repressor deor from escherichia coli str. k-12 0.903 76 249
2pfb-assembly1.cif.gz_B structure of oxidized ohrr from xanthamonas campestris 0.9023 7 59
2pfb-assembly1.cif.gz_A structure of oxidized ohrr from xanthamonas campestris 0.8991 7 58
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.8923 3 58
ID Description Score Start End Superfamily
af_P76034_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9725 6 60 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9682 1 56 1.10.10.10
af_P0A0Q0_3_60_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.968 4 60 1.10.10.10
af_P39361_78_236_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9679 75 229 3.40.50.1360
af_P32144_11_67_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9615 7 60 1.10.10.10
ID Description Score Start End GO Terms
AF-A6C955-F1-model_v4 deleted 0.9728 90 250
AF-A0A523RXZ1-F1-model_v4 DeoR-like transcriptional repressor C-terminal sensor domain-containing protein 0.9652 85 243
AF-A0A139QJX4-F1-model_v4 Lactose phosphotransferase system repressor 0.9636 74 249 GO:0016740
AF-A0A0F5PQR6-F1-model_v4 Sugar metabolism transcriptional regulator 0.9629 75 249
AF-K0W4D9-F1-model_v4 Transcriptional regulator protein, DeoR family 0.9593 83 252

Feature Viewer

pLDDT pTM Quality
88.22 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map