F131121

General Info

Members Datasets Scaffolds Average Seq Length
126 104 252 55

Family's Representative Sequence

Representative Sequence 3300035112|Ga0373932_0335847|Ga0373932_0335847_224_397
Length 57
Sequence MVMKRYKCIVCGHVYDPAVGDPDHKPPIPPGTAFEDLPADWSCPECGATKADFEEMN

Samples

Sample ID Description Type Environment
1 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
64 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
68 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
69 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
70 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
71 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
72 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
76 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
77 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
78 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
79 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
91 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
92 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
103 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
104 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0.79
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 1.59
Rhizoplane 2.38
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373932_0335847 3300035112 Bacteria 572
2 rootL2_10304008 3300003322 Unclassified 2870
3 Ga0070690_101356623 3300005330 Bacteria 571
4 Ga0070666_10931015 3300005335 Bacteria 643
5 Ga0070682_100071843 3300005337 Bacteria 2216
6 Ga0070689_100072225 3300005340 Bacteria 2697
7 Ga0070669_100113345 3300005353 Unclassified 2060
8 Ga0070669_100373192 3300005353 Bacteria 1162
9 Ga0070667_100021136 3300005367 Bacteria 5407
10 Ga0070663_100299765 3300005455 Bacteria 1286
11 Ga0070663_101817999 3300005455 Bacteria 546
12 Ga0070662_100359575 3300005457 Bacteria 1194
13 Ga0068867_100562974 3300005459 Bacteria 989
14 Ga0068867_101015029 3300005459 Bacteria 753
15 Ga0070665_100003958 3300005548 Bacteria 15623
16 Ga0070665_101875092 3300005548 Unclassified 605
17 Ga0068855_101841538 3300005563 Unclassified 614
18 Ga0068857_100213327 3300005577 Bacteria 1762
19 Ga0068859_102086999 3300005617 Bacteria 626
20 Ga0068864_100103609 3300005618 Bacteria 2526
21 Ga0068863_100000778 3300005841 Bacteria 32056
22 Ga0068858_100892768 3300005842 Bacteria 869
23 Ga0068858_101047783 3300005842 Bacteria 800
24 Ga0068858_101779517 3300005842 Bacteria 609
25 Ga0068860_100000422 3300005843 Bacteria 54588
26 Ga0068860_100008271 3300005843 Bacteria 10355
27 Ga0068862_100002578 3300005844 Bacteria 16010
28 Ga0068862_100144469 3300005844 Bacteria 2113
29 Ga0068862_101800478 3300005844 Bacteria 622
30 Ga0070717_10011408 3300006028 Bacteria 6747
31 Ga0075366_10010372 3300006195 Bacteria 5231
32 Ga0075370_10001187 3300006353 Bacteria 10975
33 Ga0075431_100293606 3300006847 Bacteria 1643
34 Ga0075433_10418658 3300006852 Bacteria 1181
35 Ga0075434_100000318 3300006871 Bacteria 34363
36 Ga0075436_100019266 3300006914 Bacteria 4676
37 Ga0097620_102086901 3300006931 Bacteria 626
38 Ga0075435_100003168 3300007076 Bacteria 11124
39 Ga0105247_10049998 3300009101 Bacteria 2572
40 Ga0105243_10588447 3300009148 Bacteria 1069
41 Ga0105241_11732447 3300009174 Bacteria 608
42 Ga0105248_10628965 3300009177 Bacteria 1211
43 Ga0105237_11344608 3300009545 Bacteria 721
44 Ga0105238_11088762 3300009551 Bacteria 821
45 Ga0105246_10477635 3300011119 Bacteria 1054
46 Ga0157379_11761967 3300014968 Bacteria 608
47 Ga0157376_13050406 3300014969 Unclassified 507
48 Ga0207712_10563842 3300025961 Bacteria 981
49 Ga0207677_11481031 3300026023 Bacteria 627
50 Ga0207703_10836602 3300026035 Bacteria 880
51 Ga0207703_11783084 3300026035 Unclassified 592
52 Ga0207648_11946667 3300026089 Bacteria 549
53 Ga0207674_10149633 3300026116 Bacteria 2292
54 Ga0268266_11341003 3300028379 Bacteria 691
55 Ga0268265_12092005 3300028380 Bacteria 573
56 Ga0268264_10006811 3300028381 Bacteria 9598
57 Ga0265319_1208472 3300028563 Bacteria 599
58 Ga0307509_10073507 3300031507 Bacteria 3559
59 Ga0307408_100216388 3300031548 Bacteria 1560
60 Ga0316576_10024772 3300031727 Bacteria 4194
61 Ga0316576_10472515 3300031727 Unclassified 924
62 Ga0316578_10366196 3300031728 Bacteria 857
63 Ga0307405_10697195 3300031731 Bacteria 840
64 Ga0316577_10048097 3300031733 Unclassified 2382
65 Ga0307409_101322189 3300031995 Bacteria 746
66 Ga0307416_100381205 3300032002 Bacteria 1440
67 Ga0307415_100839801 3300032126 Bacteria 842
68 Ga0316593_10166791 3300032168 Bacteria 806
69 Ga0373936_0514494 3300035113 Bacteria 557
70 Ga0316574_0425789 3300035398 Bacteria 834
71 Ga0373931_0466121 3300035691 Bacteria 810
72 Ga0316582_0303383 3300036647 Bacteria 1097
73 Ga0316584_0337648 3300036712 Archaea 1084
74 Ga0400484_21252 3300038725 Bacteria 3564
75 Ga0400483_009238 3300039062 Bacteria 5905
76 Ga0400483_061217 3300039062 Bacteria 1253
77 Ga0400483_161950 3300039062 Bacteria 1337
78 Ga0439436_0029675 3300041404 Bacteria 1592
79 Ga0439439_0000333 3300041406 Bacteria 7625
80 Ga0439461_0010741 3300041410 Bacteria 1687
81 Ga0439466_0004152 3300041411 Bacteria 5591
82 Ga0451855_0134630 3300041511 Bacteria 1143
83 Ga0439431_0038294 3300041997 Bacteria 1213
84 Ga0439445_0058161 3300042004 Bacteria 1053
85 Ga0439432_027973 3300042006 Bacteria 1838
86 Ga0439449_0002070 3300042007 Bacteria 7895
87 Ga0439462_0000841 3300042015 Bacteria 6420
88 Ga0450921_033178 3300042123 Bacteria 532
89 Ga0450899_010301 3300042135 Bacteria 1037
90 Ga0450906_066658 3300042145 Bacteria 643
91 Ga0439446_0021865 3300042156 Bacteria 1809
92 Ga0450909_073881 3300042185 Bacteria 548
93 Ga0439434_0030868 3300042435 Bacteria 1628
94 Ga0439434_0047409 3300042435 Bacteria 1327
95 Ga0451577_0061862 3300042876 Bacteria 3338
96 Ga0451577_0572787 3300042876 Bacteria 1025
97 Ga0451577_0768392 3300042876 Bacteria 871
98 Ga0453683_0052918 3300044673 Bacteria 2541
99 Ga0453684_0001354 3300044712 Bacteria 71546
100 Ga0453684_0038472 3300044712 Bacteria 6539
101 Ga0453684_0174074 3300044712 Bacteria 2533
102 Ga0453684_0914337 3300044712 Unclassified 939
103 Ga0453684_1962577 3300044712 Bacteria 590
104 Ga0451576_0804864 3300045051 Bacteria 987
105 Ga0495636_0011608 3300047318 Bacteria 3488
106 Ga0495636_0362586 3300047318 Bacteria 685
107 Ga0495615_0031370 3300048090 Bacteria 1274
108 Ga0496100_0668820 3300048903 Bacteria 809
109 Ga0496106_0923658 3300048909 Bacteria 688
110 Ga0496113_1394975 3300048916 Bacteria 543
111 Ga0501290_002286 3300049513 Bacteria 2484
112 Ga0501265_001822 3300049762 Bacteria 2414
113 Ga0501275_001076 3300049772 Bacteria 2792
114 Ga0501035_0000030 3300049822 Bacteria 176511
115 nmdc:mga03683_409286_c1 3300050489 Bacteria 648
116 nmdc:mga0k408_317406_c1 3300050493 Bacteria 930
117 nmdc:mga07m45_96792_c1 3300050496 Bacteria 1694
118 nmdc:mga08y16_1165404_c1 3300050511 Bacteria 743
119 nmdc:mga0n895_4843_c1 3300050512 Bacteria 11156
120 nmdc:mga0rr50_1858963_c1 3300050513 Bacteria 506
121 nmdc:mga0rr50_4012_c1 3300050513 Bacteria 8584
122 nmdc:mga08x19_23291_c1 3300050514 Bacteria 3841
123 nmdc:mga0a205_558332_c1 3300050515 Bacteria 1000
124 2512352590 2512047030 Bacteria 9031815
125 2515681205 2515154122 Bacteria 8609520
126 2902686349 2902682994 Bacteria 8951596
127 Ga0373932_0335847
128 rootL2_10304008
129 Ga0070690_101356623
130 Ga0070666_10931015
131 Ga0070682_100071843
132 Ga0070689_100072225
133 Ga0070669_100113345
134 Ga0070669_100373192
135 Ga0070667_100021136
136 Ga0070663_100299765
137 Ga0070663_101817999
138 Ga0070662_100359575
139 Ga0068867_100562974
140 Ga0068867_101015029
141 Ga0070665_100003958
142 Ga0070665_101875092
143 Ga0068855_101841538
144 Ga0068857_100213327
145 Ga0068859_102086999
146 Ga0068864_100103609
147 Ga0068863_100000778
148 Ga0068858_100892768
149 Ga0068858_101047783
150 Ga0068858_101779517
151 Ga0068860_100000422
152 Ga0068860_100008271
153 Ga0068862_100002578
154 Ga0068862_100144469
155 Ga0068862_101800478
156 Ga0070717_10011408
157 Ga0075366_10010372
158 Ga0075370_10001187
159 Ga0075431_100293606
160 Ga0075433_10418658
161 Ga0075434_100000318
162 Ga0075436_100019266
163 Ga0097620_102086901
164 Ga0075435_100003168
165 Ga0105247_10049998
166 Ga0105243_10588447
167 Ga0105241_11732447
168 Ga0105248_10628965
169 Ga0105237_11344608
170 Ga0105238_11088762
171 Ga0105246_10477635
172 Ga0157379_11761967
173 Ga0157376_13050406
174 Ga0207712_10563842
175 Ga0207677_11481031
176 Ga0207703_10836602
177 Ga0207703_11783084
178 Ga0207648_11946667
179 Ga0207674_10149633
180 Ga0268266_11341003
181 Ga0268265_12092005
182 Ga0268264_10006811
183 Ga0265319_1208472
184 Ga0307509_10073507
185 Ga0307408_100216388
186 Ga0316576_10024772
187 Ga0316576_10472515
188 Ga0316578_10366196
189 Ga0307405_10697195
190 Ga0316577_10048097
191 Ga0307409_101322189
192 Ga0307416_100381205
193 Ga0307415_100839801
194 Ga0316593_10166791
195 Ga0373936_0514494
196 Ga0316574_0425789
197 Ga0373931_0466121
198 Ga0316582_0303383
199 Ga0316584_0337648
200 Ga0400484_21252
201 Ga0400483_009238
202 Ga0400483_061217
203 Ga0400483_161950
204 Ga0439436_0029675
205 Ga0439439_0000333
206 Ga0439461_0010741
207 Ga0439466_0004152
208 Ga0451855_0134630
209 Ga0439431_0038294
210 Ga0439445_0058161
211 Ga0439432_027973
212 Ga0439449_0002070
213 Ga0439462_0000841
214 Ga0450921_033178
215 Ga0450899_010301
216 Ga0450906_066658
217 Ga0439446_0021865
218 Ga0450909_073881
219 Ga0439434_0030868
220 Ga0439434_0047409
221 Ga0451577_0061862
222 Ga0451577_0572787
223 Ga0451577_0768392
224 Ga0453683_0052918
225 Ga0453684_0001354
226 Ga0453684_0038472
227 Ga0453684_0174074
228 Ga0453684_0914337
229 Ga0453684_1962577
230 Ga0451576_0804864
231 Ga0495636_0011608
232 Ga0495636_0362586
233 Ga0495615_0031370
234 Ga0496100_0668820
235 Ga0496106_0923658
236 Ga0496113_1394975
237 Ga0501290_002286
238 Ga0501265_001822
239 Ga0501275_001076
240 Ga0501035_0000030
241 nmdc:mga03683_409286_c1
242 nmdc:mga0k408_317406_c1
243 nmdc:mga07m45_96792_c1
244 nmdc:mga08y16_1165404_c1
245 nmdc:mga0n895_4843_c1
246 nmdc:mga0rr50_1858963_c1
247 nmdc:mga0rr50_4012_c1
248 nmdc:mga08x19_23291_c1
249 nmdc:mga0a205_558332_c1
250 2512352590
251 2515681205
252 2902686349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00301

Rubredoxin

Rubredoxin

5

53

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rz6-assembly1.cif.gz_A neutron structure of perdeuterated rubredoxin using 40 hours 1st pass data 0.9836 6 53
3rzt-assembly1.cif.gz_A neutron structure of perdeuterated rubredoxin using rapid (14 hours) data 0.9825 6 53
1iu6-assembly1.cif.gz_A neutron crystal structure of the rubredoxin mutant from pyrococcus furiosus 0.9823 6 53
5xpd-assembly1.cif.gz_A sugar transporter of atsweet13 in inward-facing state with a substrate analog 0.9789 5 55
1fhh-assembly1.cif.gz_A x-ray crystal structure of oxidized rubredoxin 0.9788 5 56
ID Description Score Start End Superfamily
5xpdA02 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.9789 5 55 2.20.28.10
1r0hA00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.9754 5 56 2.20.28.10
af_A0A140LGM9_250_592_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.9724 5 15 3.90.70.10
af_A4IA95_233_330_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.963 5 15 3.30.40.10
af_A0A1D8PFU3_415_811_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.9622 5 15 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A369WST9-F1-model_v4 Rubredoxin 1.004 4 54 GO:0005506
GO:0009055
GO:0043448
AF-A0A445MYQ9-F1-model_v4 Rubredoxin 1.004 5 54 GO:0005506
GO:0009055
GO:0043448
AF-O26258-F1-model_v4 Probable rubredoxin (RD) 1.003 5 56 GO:0005506
GO:0009055
GO:0043448
AF-A0A318EFQ4-F1-model_v4 Rubredoxin 1.002 6 55 GO:0005506
GO:0009055
GO:0043448
AF-A0A1V6K2W2-F1-model_v4 Rubredoxin 1.001 5 54 GO:0005506
GO:0009055
GO:0043448

Map