F130961

General Info

Members Datasets Scaffolds Average Seq Length
126 100 253 154

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10243324|Ga0307513_102433242
Length 183
Sequence MNSKRASPPIDVQRLQRLDSQLCFALYSTSLAMTKLYKPLLAPLGLTYPQYLAMLVLWETDSIGVNELGDRLFLDSGTLTPLLKRMQAAGWVERERDQADERRVIVTLTTAGRALRRKAAQVPLALAQATGCGLDEVVALTTRVQTLRDHVVAHAESANAGTYSIGSFSNDPPHPPLKARKAR

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
25 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
26 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
27 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
51 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
58 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
59 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
60 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
61 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
67 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
68 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
69 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
70 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
71 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
72 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
77 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
78 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
88 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
91 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
92 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
93 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
94 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
95 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
96 2738541337 Pelomonas sp. BT06 Isolate Unclassified
97 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
98 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
99 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
100 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.48
Nodule 0.79
Rhizoplane 1.59
Rhizosphere 46.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10243324 3300031456 Bacteria 1602
2 JGI25150J39212_1016717 3300002774 Bacteria 1198
3 JGI25159J45721_1009049 3300002987 Bacteria 2667
4 JGI25151J46595_10003076 3300003187 Bacteria 9408
5 JGI25151J46595_10019318 3300003187 Bacteria 2897
6 rootH1_10013220 3300003316 Bacteria 1126
7 rootH1_10013220 3300003323 Bacteria 6268
8 JGI25160J50197_1071502 3300003354 Bacteria 662
9 Ga0055526_1005244 3300003771 Bacteria 7520
10 Ga0055526_1009592 3300003771 Bacteria 4630
11 Ga0055524_1000145 3300003775 Bacteria 84202
12 Ga0055524_1012954 3300003775 Bacteria 3173
13 Ga0055536_1000440 3300003781 Bacteria 29320
14 Ga0055534_1001862 3300003784 Bacteria 7870
15 Ga0055528_1011895 3300003790 Bacteria 3415
16 Ga0055528_1020242 3300003790 Bacteria 2167
17 Ga0055530_10000244 3300003791 Bacteria 49128
18 Ga0055540_1000237 3300003792 Bacteria 50309
19 Ga0055531_10000107 3300003794 Bacteria 91062
20 Ga0065165_1110848 3300005262 Bacteria 676
21 Ga0070665_100035572 3300005548 Bacteria 5008
22 Ga0075366_10000464 3300006195 Bacteria 18904
23 Ga0075430_100388518 3300006846 Bacteria 1152
24 Ga0079104_1057439 3300006946 Bacteria 848
25 Ga0105248_10041205 3300009177 Bacteria 5177
26 Ga0105239_11151765 3300010375 Bacteria 893
27 Ga0157380_10580229 3300014326 Bacteria 1105
28 Ga0157376_10028875 3300014969 Bacteria 4413
29 Ga0207425_1002316 3300025245 Bacteria 6830
30 Ga0209759_1005424 3300025256 Bacteria 4471
31 Ga0209129_1028366 3300025258 Bacteria 952
32 Ga0209565_1000026 3300025263 Bacteria 365910
33 Ga0209673_1000009 3300025273 Bacteria 620735
34 Ga0209130_1000863 3300025284 Bacteria 24942
35 Ga0209130_1015785 3300025284 Bacteria 1848
36 Ga0209675_1000171 3300025291 Bacteria 75668
37 Ga0209675_1000849 3300025291 Bacteria 19886
38 Ga0209675_1006899 3300025291 Bacteria 4463
39 Ga0209676_1000013 3300025292 Bacteria 816080
40 Ga0209676_1000053 3300025292 Bacteria 370111
41 Ga0209025_1000688 3300025294 Bacteria 57984
42 Ga0209025_1072073 3300025294 Bacteria 1220
43 Ga0209564_1000243 3300025295 Bacteria 118066
44 Ga0209564_1000451 3300025295 Bacteria 69674
45 Ga0209050_1000008 3300025298 Bacteria 1144179
46 Ga0209256_1000003 3300025299 Bacteria 1661127
47 Ga0209256_1000011 3300025299 Bacteria 865309
48 Ga0209256_1000086 3300025299 Bacteria 218837
49 Ga0207426_1016236 3300025302 Bacteria 2679
50 Ga0209051_1000005 3300025303 Bacteria 1142353
51 Ga0209051_1021226 3300025303 Bacteria 2772
52 Ga0209257_1000032 3300025304 Bacteria 680354
53 Ga0209257_1000048 3300025304 Bacteria 455536
54 Ga0207687_10085390 3300025927 Bacteria 2290
55 Ga0207711_10030599 3300025941 Bacteria 4542
56 Ga0209813_10317432 3300027866 Bacteria 609
57 Ga0268266_10287079 3300028379 Bacteria 1531
58 Ga0265316_10000393 3300031344 Bacteria 49924
59 Ga0307408_100002845 3300031548 Bacteria 12005
60 Ga0307408_100647059 3300031548 Bacteria 945
61 Ga0307516_10222054 3300031730 Bacteria 1598
62 Ga0307406_10048074 3300031901 Bacteria 2692
63 Ga0307412_10098904 3300031911 Bacteria 2058
64 Ga0307412_10844609 3300031911 Bacteria 798
65 Ga0307416_100256859 3300032002 Bacteria 1705
66 Ga0307411_11625421 3300032005 Bacteria 597
67 Ga0307507_10048308 3300033179 Bacteria 4142
68 Ga0373934_0053602 3300035086 Bacteria 1600
69 Ga0373954_0566705 3300035118 Bacteria 563
70 Ga0395898_0011746 3300037466 Bacteria 9079
71 Ga0395905_0014252 3300037471 Bacteria 7595
72 Ga0395905_0058880 3300037471 Bacteria 3591
73 Ga0395905_0743262 3300037471 Bacteria 883
74 Ga0395905_1024519 3300037471 Bacteria 729
75 Ga0436361_0633280 3300039447 Bacteria 103480
76 Ga0436361_0951025 3300039447 Bacteria 6039
77 Ga0451853_2102297 3300041512 Bacteria 586
78 Ga0439462_0208935 3300042015 Bacteria 557
79 Ga0450888_018171 3300042126 Bacteria 878
80 Ga0439444_0052029 3300042437 Bacteria 835
81 Ga0439460_0034752 3300042461 Bacteria 1455
82 Ga0450893_0004361 3300042532 Bacteria 2254
83 Ga0451577_0001380 3300042876 Bacteria 32538
84 Ga0451577_0007795 3300042876 Bacteria 10490
85 Ga0451576_0084543 3300045051 Bacteria 3301
86 Ga0451576_0463754 3300045051 Bacteria 1330
87 Ga0495638_0018229 3300046460 Bacteria 4665
88 Ga0495585_0042291 3300046492 Bacteria 2553
89 Ga0495616_0310451 3300046513 Bacteria 664
90 Ga0495648_0303406 3300046524 Bacteria 747
91 Ga0495663_0192239 3300046525 Bacteria 710
92 Ga0495654_0047994 3300046530 Bacteria 2097
93 Ga0495633_0309179 3300046558 Bacteria 718
94 Ga0495656_0052447 3300046615 Bacteria 1749
95 Ga0495656_0430280 3300046615 Bacteria 693
96 Ga0495661_0018995 3300046665 Bacteria 4510
97 Ga0495588_0346545 3300046674 Bacteria 781
98 Ga0495669_0224524 3300046684 Bacteria 901
99 Ga0495670_0097131 3300046691 Bacteria 1513
100 Ga0495636_0044227 3300047318 Bacteria 1854
101 Ga0495677_0431174 3300047445 Bacteria 522
102 Ga0495685_126538 3300047447 Bacteria 837
103 Ga0495686_0041246 3300047472 Bacteria 2939
104 Ga0496110_0023189 3300048913 Bacteria 5278
105 Ga0496113_0156899 3300048916 Bacteria 1798
106 Ga0496116_0232327 3300048919 Bacteria 934
107 Ga0496124_0001079 3300048927 Bacteria 43104
108 Ga0496124_0016311 3300048927 Bacteria 7070
109 Ga0496125_0034486 3300048928 Bacteria 4460
110 Ga0501034_0187365 3300049571 Bacteria 2032
111 Ga0501067_0300259 3300049583 Bacteria 894
112 Ga0501252_026404 3300049682 Bacteria 786
113 Ga0501265_031931 3300049762 Bacteria 761
114 nmdc:mga0k408_403174_c1 3300050493 Bacteria 814
115 nmdc:mga0k408_654_c1 3300050493 Bacteria 18954
116 nmdc:mga04h51_352123_c1 3300050495 Bacteria 609
117 Ga0500644_0002107 3300053088 Bacteria 5049
118 Ga0500644_0328802 3300053088 Bacteria 658
119 Ga0500562_001916 3300053108 Bacteria 5216
120 Ga0500559_0001747 3300053136 Bacteria 11909
121 Ga0500645_032896 3300053730 Bacteria 1553
122 2644259989 2643221646 Bacteria 6433402
123 2739057640 2738541337 Bacteria 6183410
124 2809009156 2808606390 Bacteria 8476311
125 2809016307 2808606391 Bacteria 8308166
126 2842718227 2842718218 Bacteria 4560148
127 2846042344 2846037992 Bacteria 4526407
128 Ga0307513_10243324
129 JGI25150J39212_1016717
130 JGI25159J45721_1009049
131 JGI25151J46595_10003076
132 JGI25151J46595_10019318
133 rootH1_10013220
134 JGI25160J50197_1071502
135 Ga0055526_1005244
136 Ga0055526_1009592
137 Ga0055524_1000145
138 Ga0055524_1012954
139 Ga0055536_1000440
140 Ga0055534_1001862
141 Ga0055528_1011895
142 Ga0055528_1020242
143 Ga0055530_10000244
144 Ga0055540_1000237
145 Ga0055531_10000107
146 Ga0065165_1110848
147 Ga0070665_100035572
148 Ga0075366_10000464
149 Ga0075430_100388518
150 Ga0079104_1057439
151 Ga0105248_10041205
152 Ga0105239_11151765
153 Ga0157380_10580229
154 Ga0157376_10028875
155 Ga0207425_1002316
156 Ga0209759_1005424
157 Ga0209129_1028366
158 Ga0209565_1000026
159 Ga0209673_1000009
160 Ga0209130_1000863
161 Ga0209130_1015785
162 Ga0209675_1000171
163 Ga0209675_1000849
164 Ga0209675_1006899
165 Ga0209676_1000013
166 Ga0209676_1000053
167 Ga0209025_1000688
168 Ga0209025_1072073
169 Ga0209564_1000243
170 Ga0209564_1000451
171 Ga0209050_1000008
172 Ga0209256_1000003
173 Ga0209256_1000011
174 Ga0209256_1000086
175 Ga0207426_1016236
176 Ga0209051_1000005
177 Ga0209051_1021226
178 Ga0209257_1000032
179 Ga0209257_1000048
180 Ga0207687_10085390
181 Ga0207711_10030599
182 Ga0209813_10317432
183 Ga0268266_10287079
184 Ga0265316_10000393
185 Ga0307408_100002845
186 Ga0307408_100647059
187 Ga0307516_10222054
188 Ga0307406_10048074
189 Ga0307412_10098904
190 Ga0307412_10844609
191 Ga0307416_100256859
192 Ga0307411_11625421
193 Ga0307507_10048308
194 Ga0373934_0053602
195 Ga0373954_0566705
196 Ga0395898_0011746
197 Ga0395905_0014252
198 Ga0395905_0058880
199 Ga0395905_0743262
200 Ga0395905_1024519
201 Ga0436361_0633280
202 Ga0436361_0951025
203 Ga0451853_2102297
204 Ga0439462_0208935
205 Ga0450888_018171
206 Ga0439444_0052029
207 Ga0439460_0034752
208 Ga0450893_0004361
209 Ga0451577_0001380
210 Ga0451577_0007795
211 Ga0451576_0084543
212 Ga0451576_0463754
213 Ga0495638_0018229
214 Ga0495585_0042291
215 Ga0495616_0310451
216 Ga0495648_0303406
217 Ga0495663_0192239
218 Ga0495654_0047994
219 Ga0495633_0309179
220 Ga0495656_0052447
221 Ga0495656_0430280
222 Ga0495661_0018995
223 Ga0495588_0346545
224 Ga0495669_0224524
225 Ga0495670_0097131
226 Ga0495636_0044227
227 Ga0495677_0431174
228 Ga0495685_126538
229 Ga0495686_0041246
230 Ga0496110_0023189
231 Ga0496113_0156899
232 Ga0496116_0232327
233 Ga0496124_0001079
234 Ga0496124_0016311
235 Ga0496125_0034486
236 Ga0501034_0187365
237 Ga0501067_0300259
238 Ga0501252_026404
239 Ga0501265_031931
240 nmdc:mga0k408_403174_c1
241 nmdc:mga0k408_654_c1
242 nmdc:mga04h51_352123_c1
243 Ga0500644_0002107
244 Ga0500644_0328802
245 Ga0500562_001916
246 Ga0500559_0001747
247 Ga0500645_032896
248 2644259989
249 2739057640
250 2809009156
251 2809016307
252 2842718227
253 2846042344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

46

104

0.98

PF12802

MarR_2

MarR family

44

103

0.97

PF22381

Staph_reg_Sar_Rot

Transcriptional regulator SarA/Rot

35

118

0.96

PF13463

HTH_27

Winged helix DNA-binding domain

46

112

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pex-assembly1.cif.gz_A structure of reduced c22s ohrr from xanthamonas campestris 0.9811 9 149
2pex-assembly1.cif.gz_A structure of reduced c22s ohrr from xanthamonas campestris 0.96 9 149
1z9c-assembly2.cif.gz_C crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna 0.9551 12 147
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9471 47 105
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9374 47 86
ID Description Score Start End Superfamily
2pexB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9683 9 149 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 59 104 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9471 47 105 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9464 42 103 1.10.10.10
2pexB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 9 149 1.10.10.10
ID Description Score Start End GO Terms
AF-X5A0G2-F1-model_v4 HTH-type transcriptional regulator sarZ 0.9898 11 148 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A4Q5QAL3-F1-model_v4 deleted 0.9896 11 148
AF-A0A0Q6XPR2-F1-model_v4 MarR family transcriptional regulator 0.9888 12 147 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-A0A380PVI3-F1-model_v4 Homoprotocatechuate degradative operon repressor 0.9887 18 148 GO:0003677
GO:0003700
GO:0005737
GO:0006950
AF-F2JUW7-F1-model_v4 Transcriptional regulator, MarR family 0.9882 9 148 GO:0003677
GO:0003700
GO:0005737
GO:0006950

Map