F130039

General Info

Members Datasets Scaffolds Average Seq Length
126 100 118 316

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10054944|Ga0075370_100549442
Length 336
Sequence MMTSAPPPLSSALRCVCLAGPTAAGKTACALAIADALRNERPVEIVSVDSALVYRGMDIGTAKPSAAERATVPHHLIDVIEPTQAYSAARFVADAQHLISQIEERGHLPLLVGGTMLYFKALFDGIDAMPAADPAVRAEIDARAARDGWPALHTQLERVDPITAARLAPGDGQRIQRALEVWQLSGRPLSSFHARAGRDTAGRAPPPMISLEPTDRAWLHRRISERFDAMLDAGLVDEVRSLRARGDLHAELPSMRCVGYRQAWQALDAGLTGDSLLDTVRETGRAATRQLAKRQITWLRGMPQREVIACDADGALESAVSAAIAHARRLASSKAV

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221660 Methylibium sp. Root1272 Isolate Unclassified
8 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
68 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
91 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
96 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
97 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
98 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
99 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 1.59
Rhizoplane 2.38
Rhizosphere 73.02
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10016365 3300003322 Bacteria 7332
2 Ga0055540_1012138 3300003792 Bacteria 2726
3 Ga0070670_100002708 3300005331 Bacteria 14639
4 Ga0070677_10048860 3300005333 Bacteria 1701
5 Ga0068868_100347027 3300005338 Bacteria 1270
6 Ga0070675_100167973 3300005354 Bacteria 1890
7 Ga0070671_100053211 3300005355 Bacteria 3365
8 Ga0070671_100076743 3300005355 Bacteria 2792
9 Ga0070673_100116749 3300005364 Bacteria 2220
10 Ga0070708_100299133 3300005445 Bacteria 1515
11 Ga0070663_100185217 3300005455 Bacteria 1617
12 Ga0068867_100000062 3300005459 Bacteria 65188
13 Ga0068867_100222302 3300005459 Bacteria 1522
14 Ga0070706_100001946 3300005467 Bacteria 21285
15 Ga0070672_100101636 3300005543 Bacteria 2332
16 Ga0070672_100152914 3300005543 Bacteria 1910
17 Ga0070672_100220554 3300005543 Bacteria 1590
18 Ga0068864_100038025 3300005618 Bacteria 4108
19 Ga0068862_100006406 3300005844 Bacteria 9788
20 Ga0068862_100015435 3300005844 Bacteria 6345
21 Ga0075368_10014037 3300006042 Bacteria 2951
22 Ga0075370_10054944 3300006353 Bacteria 2262
23 Ga0079104_1000017 3300006946 Bacteria 313784
24 Ga0114129_10130613 3300009147 Bacteria 3450
25 Ga0105243_10003920 3300009148 Bacteria 11876
26 Ga0105248_10339895 3300009177 Bacteria 1690
27 Ga0182008_10014168 3300014497 Bacteria 4181
28 Ga0157377_10000027 3300014745 Bacteria 135472
29 Ga0157376_10232831 3300014969 Bacteria 1712
30 Ga0163161_10103955 3300017792 Bacteria 2117
31 Ga0209050_1002506 3300025298 Bacteria 15458
32 Ga0209051_1000770 3300025303 Bacteria 33998
33 Ga0207682_10017474 3300025893 Bacteria 2802
34 Ga0207645_10012022 3300025907 Bacteria 5885
35 Ga0207650_10001000 3300025925 Bacteria 21248
36 Ga0207650_10167522 3300025925 Bacteria 1744
37 Ga0207659_10153748 3300025926 Bacteria 1799
38 Ga0207644_10088665 3300025931 Bacteria 2301
39 Ga0207644_10344549 3300025931 Bacteria 1209
40 Ga0207709_10004367 3300025935 Bacteria 8179
41 Ga0207665_10175823 3300025939 Bacteria 1548
42 Ga0207691_10177914 3300025940 Bacteria 1860
43 Ga0207691_10208269 3300025940 Bacteria 1700
44 Ga0207651_10207856 3300025960 Bacteria 1573
45 Ga0207651_10214354 3300025960 Bacteria 1552
46 Ga0207678_10224358 3300026067 Bacteria 1609
47 Ga0207648_10000308 3300026089 Bacteria 53542
48 Ga0207648_10010723 3300026089 Bacteria 8663
49 Ga0207648_10244966 3300026089 Bacteria 1597
50 Ga0207648_10413709 3300026089 Bacteria 1223
51 Ga0207676_10132736 3300026095 Bacteria 2120
52 Ga0207675_100233787 3300026118 Bacteria 1774
53 Ga0207683_10177280 3300026121 Bacteria 1932
54 Ga0207683_10200918 3300026121 Bacteria 1812
55 Ga0207683_10323259 3300026121 Bacteria 1413
56 Ga0209281_1000042 3300027111 Bacteria 344748
57 Ga0268265_10094281 3300028380 Bacteria 2400
58 Ga0307517_10106607 3300028786 Bacteria 2165
59 Ga0307515_10000101 3300028794 Bacteria 199593
60 Ga0307515_10001774 3300028794 Bacteria 48109
61 Ga0307515_10081961 3300028794 Bacteria 4181
62 Ga0307515_10097188 3300028794 Bacteria 3602
63 Ga0265328_10010567 3300031239 Bacteria 3711
64 Ga0265327_10000419 3300031251 Bacteria 77672
65 Ga0265316_10108784 3300031344 Bacteria 2101
66 Ga0307509_10244933 3300031507 Bacteria 1582
67 Ga0307514_10001428 3300031649 Bacteria 29364
68 Ga0307516_10003374 3300031730 Bacteria 20612
69 Ga0307516_10146421 3300031730 Bacteria 2127
70 Ga0307406_10166486 3300031901 Bacteria 1591
71 Ga0307412_10239155 3300031911 Bacteria 1403
72 Ga0307414_10297345 3300032004 Bacteria 1364
73 Ga0307510_10002283 3300033180 Bacteria 21628
74 Ga0373937_0229437 3300036401 Bacteria 1748
75 Ga0373925_0025414 3300037068 Bacteria 4326
76 Ga0395905_0001198 3300037471 Bacteria 32426
77 Ga0451804_0155245 3300041463 Bacteria 2617
78 Ga0450888_003229 3300042126 Bacteria 1642
79 Ga0450903_005271 3300042138 Bacteria 2169
80 Ga0439434_0081088 3300042435 Bacteria 1030
81 Ga0450893_0003278 3300042532 Bacteria 2546
82 Ga0451577_0082735 3300042876 Bacteria 2863
83 Ga0466965_0128710 3300044683 Bacteria 1311
84 Ga0466966_0009977 3300044684 Bacteria 6293
85 Ga0466966_0051056 3300044684 Bacteria 2629
86 Ga0466961_0023286 3300044693 Bacteria 3984
87 Ga0466961_0090548 3300044693 Bacteria 1931
88 Ga0466964_0063794 3300044706 Bacteria 1539
89 Ga0466971_0032542 3300044719 Bacteria 2336
90 Ga0466970_0012676 3300044765 Bacteria 4312
91 Ga0466970_0143884 3300044765 Bacteria 1314
92 Ga0466957_0015902 3300044842 Bacteria 4397
93 Ga0466957_0399811 3300044842 Bacteria 939
94 Ga0466959_0000458 3300045049 Bacteria 23709
95 Ga0451576_0001482 3300045051 Bacteria 39694
96 Ga0451576_0005149 3300045051 Bacteria 16555
97 Ga0495590_0007192 3300046457 Bacteria 4304
98 Ga0495632_0008652 3300046519 Bacteria 6215
99 Ga0495597_0000268 3300046542 Bacteria 47622
100 Ga0495597_0052111 3300046542 Bacteria 1802
101 Ga0495625_0035427 3300046660 Bacteria 3679
102 Ga0495687_010883 3300047443 Bacteria 4941
103 Ga0496102_0004156 3300048905 Bacteria 12262
104 Ga0496102_0014470 3300048905 Bacteria 6855
105 Ga0496124_0003623 3300048927 Bacteria 18748
106 Ga0501031_0001000 3300049568 Bacteria 17145
107 Ga0501198_000071 3300049649 Bacteria 27325
108 Ga0501222_000080 3300049662 Bacteria 27300
109 Ga0501081_0085055 3300049743 Bacteria 2219
110 nmdc:mga0k408_136087_c1 3300050493 Bacteria 1460
111 Ga0500578_0000236 3300053086 Bacteria 68048
112 Ga0500651_0097972 3300053093 Bacteria 1800
113 Ga0500642_0006724 3300053130 Bacteria 3812
114 Ga0500652_001180 3300053131 Bacteria 8341
115 Ga0500622_0002247 3300053156 Bacteria 14199
116 Ga0500622_0030729 3300053156 Bacteria 2819
117 Ga0590071_003060 3300059421 Bacteria 4147
118 Ga0466962_0001244 3300061719 Bacteria 11741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042126 Ga0450888_003229 Ga0450888_003229_19_819 266
2 3300049743 Ga0501081_0085055 Ga0501081_0085055_852_1736 271
3 3300044842 Ga0466957_0399811 Ga0466957_0399811_87_923 278
4 3300044684 Ga0466966_0009977 Ga0466966_0009977_5406_6275 284
5 3300036401 Ga0373937_0229437 Ga0373937_0229437_428_1375 294
6 3300026118 Ga0207675_100233787 Ga0207675_1002337871 298
7 3300037068 Ga0373925_0025414 Ga0373925_0025414_1324_2235 303
8 3300009147 Ga0114129_10130613 Ga0114129_101306132 305
9 3300028794 Ga0307515_10097188 Ga0307515_100971882 306
10 3300005445 Ga0070708_100299133 Ga0070708_1002991332 307
11 3300042435 Ga0439434_0081088 Ga0439434_0081088_62_985 307
12 iso_pu_bacteria 2585428057 2587729931 307
13 iso_pu_bacteria 2585428058 2587734313 307
14 iso_pu_bacteria 2643221592 2643969848 307
15 iso_pu_bacteria 2643221625 2644141969 307
16 iso_pu_bacteria 2643221648 2644273347 307
17 3300028794 Ga0307515_10000101 Ga0307515_1000010180 308
18 3300005844 Ga0068862_100006406 Ga0068862_1000064067 310
19 3300005844 Ga0068862_100015435 Ga0068862_1000154356 310
20 3300028380 Ga0268265_10094281 Ga0268265_100942812 310
21 3300042876 Ga0451577_0082735 Ga0451577_0082735_747_1679 310
22 3300025298 Ga0209050_1002506 Ga0209050_10025067 311
23 3300041463 Ga0451804_0155245 Ga0451804_0155245_1414_2352 311
24 3300050493 nmdc:mga0k408_136087_c1 nmdc:mga0k408_136087_c1_64_1002 311
25 3300053086 Ga0500578_0000236 Ga0500578_0000236_7404_8342 311
26 3300053093 Ga0500651_0097972 Ga0500651_0097972_82_1020 311
27 3300053130 Ga0500642_0006724 Ga0500642_0006724_1839_2777 311
28 3300053131 Ga0500652_001180 Ga0500652_001180_5392_6330 311
29 3300053156 Ga0500622_0002247 Ga0500622_0002247_7868_8806 311
30 iso_pu_bacteria 2588253510 2588295237 311
31 3300031911 Ga0307412_10239155 Ga0307412_102391552 312
32 3300037471 Ga0395905_0001198 Ga0395905_0001198_23924_24874 312
33 3300042138 Ga0450903_005271 Ga0450903_005271_1108_2046 312
34 3300042532 Ga0450893_0003278 Ga0450893_0003278_1269_2207 312
35 3300045051 Ga0451576_0005149 Ga0451576_0005149_1273_2211 312
36 3300059421 Ga0590071_003060 Ga0590071_003060_3078_4016 312
37 3300006042 Ga0075368_10014037 Ga0075368_100140373 313
38 3300031239 Ga0265328_10010567 Ga0265328_100105673 313
39 3300031251 Ga0265327_10000419 Ga0265327_1000041924 313
40 3300045051 Ga0451576_0001482 Ga0451576_0001482_35927_36868 313
41 3300048905 Ga0496102_0014470 Ga0496102_0014470_5004_5948 314
42 3300049649 Ga0501198_000071 Ga0501198_000071_16803_17747 314
43 3300049662 Ga0501222_000080 Ga0501222_000080_16771_17715 314
44 3300005467 Ga0070706_100001946 Ga0070706_1000019463 315
45 3300028786 Ga0307517_10106607 Ga0307517_101066072 315
46 3300031344 Ga0265316_10108784 Ga0265316_101087842 315
47 3300031730 Ga0307516_10146421 Ga0307516_101464212 315
48 3300031901 Ga0307406_10166486 Ga0307406_101664862 315
49 3300053156 Ga0500622_0030729 Ga0500622_0030729_657_1607 315
50 3300005331 Ga0070670_100002708 Ga0070670_1000027086 316
51 3300005333 Ga0070677_10048860 Ga0070677_100488602 316
52 3300005338 Ga0068868_100347027 Ga0068868_1003470272 316
53 3300005354 Ga0070675_100167973 Ga0070675_1001679733 316
54 3300005355 Ga0070671_100053211 Ga0070671_1000532114 316
55 3300005364 Ga0070673_100116749 Ga0070673_1001167492 316
56 3300005455 Ga0070663_100185217 Ga0070663_1001852171 316
57 3300005459 Ga0068867_100222302 Ga0068867_1002223022 316
58 3300005543 Ga0070672_100101636 Ga0070672_1001016362 316
59 3300005543 Ga0070672_100152914 Ga0070672_1001529142 316
60 3300005543 Ga0070672_100220554 Ga0070672_1002205542 316
61 3300005618 Ga0068864_100038025 Ga0068864_1000380252 316
62 3300009177 Ga0105248_10339895 Ga0105248_103398952 316
63 3300014969 Ga0157376_10232831 Ga0157376_102328313 316
64 3300017792 Ga0163161_10103955 Ga0163161_101039553 316
65 3300025893 Ga0207682_10017474 Ga0207682_100174742 316
66 3300025925 Ga0207650_10001000 Ga0207650_1000100015 316
67 3300025925 Ga0207650_10167522 Ga0207650_101675223 316
68 3300025926 Ga0207659_10153748 Ga0207659_101537482 316
69 3300025931 Ga0207644_10088665 Ga0207644_100886653 316
70 3300025939 Ga0207665_10175823 Ga0207665_101758232 316
71 3300025940 Ga0207691_10177914 Ga0207691_101779143 316
72 3300025940 Ga0207691_10208269 Ga0207691_102082693 316
73 3300025960 Ga0207651_10207856 Ga0207651_102078562 316
74 3300025960 Ga0207651_10214354 Ga0207651_102143542 316
75 3300026067 Ga0207678_10224358 Ga0207678_102243583 316
76 3300026089 Ga0207648_10244966 Ga0207648_102449662 316
77 3300026089 Ga0207648_10413709 Ga0207648_104137092 316
78 3300026095 Ga0207676_10132736 Ga0207676_101327362 316
79 3300026121 Ga0207683_10177280 Ga0207683_101772802 316
80 3300026121 Ga0207683_10200918 Ga0207683_102009182 316
81 3300026121 Ga0207683_10323259 Ga0207683_103232592 316
82 3300033180 Ga0307510_10002283 Ga0307510_1000228322 316
83 3300028794 Ga0307515_10081961 Ga0307515_100819613 317
84 3300031649 Ga0307514_10001428 Ga0307514_1000142827 317
85 3300031730 Ga0307516_10003374 Ga0307516_1000337417 317
86 3300005355 Ga0070671_100076743 Ga0070671_1000767433 318
87 3300006946 Ga0079104_1000017 Ga0079104_1000017265 318
88 3300025907 Ga0207645_10012022 Ga0207645_100120225 318
89 3300025931 Ga0207644_10344549 Ga0207644_103445492 318
90 3300026089 Ga0207648_10010723 Ga0207648_100107234 318
91 3300027111 Ga0209281_1000042 Ga0209281_100004284 318
92 3300044693 Ga0466961_0023286 Ga0466961_0023286_579_1553 318
93 3300044719 Ga0466971_0032542 Ga0466971_0032542_992_1966 318
94 3300044765 Ga0466970_0012676 Ga0466970_0012676_3267_4241 318
95 3300044842 Ga0466957_0015902 Ga0466957_0015902_2560_3534 318
96 3300045049 Ga0466959_0000458 Ga0466959_0000458_17641_18615 318
97 3300005459 Ga0068867_100000062 Ga0068867_10000006216 319
98 3300009148 Ga0105243_10003920 Ga0105243_1000392013 319
99 3300014745 Ga0157377_10000027 Ga0157377_1000002729 319
100 3300025935 Ga0207709_10004367 Ga0207709_100043676 319
101 3300026089 Ga0207648_10000308 Ga0207648_1000030830 319
102 3300028794 Ga0307515_10001774 Ga0307515_1000177453 319
103 3300048905 Ga0496102_0004156 Ga0496102_0004156_8246_9220 319
104 3300048927 Ga0496124_0003623 Ga0496124_0003623_16430_17416 319
105 3300003792 Ga0055540_1012138 Ga0055540_10121383 321
106 3300014497 Ga0182008_10014168 Ga0182008_100141682 321
107 3300025303 Ga0209051_1000770 Ga0209051_100077013 321
108 3300031507 Ga0307509_10244933 Ga0307509_102449332 322
109 3300046457 Ga0495590_0007192 Ga0495590_0007192_3086_4063 322
110 iso_pu_bacteria 2643221660 2644337582 322
111 3300049568 Ga0501031_0001000 Ga0501031_0001000_4091_5074 323
112 iso_pu_bacteria 2919704043 2919705076 323
113 3300044683 Ga0466965_0128710 Ga0466965_0128710_23_1027 326
114 3300044684 Ga0466966_0051056 Ga0466966_0051056_55_1059 326
115 3300044693 Ga0466961_0090548 Ga0466961_0090548_702_1706 326
116 3300044706 Ga0466964_0063794 Ga0466964_0063794_466_1470 326
117 3300044765 Ga0466970_0143884 Ga0466970_0143884_293_1297 326
118 3300046519 Ga0495632_0008652 Ga0495632_0008652_3702_4703 326
119 3300046542 Ga0495597_0052111 Ga0495597_0052111_242_1243 326
120 3300046660 Ga0495625_0035427 Ga0495625_0035427_457_1458 326
121 3300047443 Ga0495687_010883 Ga0495687_010883_1782_2783 326
122 3300061719 Ga0466962_0001244 Ga0466962_0001244_1447_2451 326
123 3300006353 Ga0075370_10054944 Ga0075370_100549442 328
124 3300032004 Ga0307414_10297345 Ga0307414_102973452 328
125 3300046542 Ga0495597_0000268 Ga0495597_0000268_23101_24102 328
126 3300003322 rootL2_10016365 rootL2_100163656 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

52

302

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8952 11 324
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8725 11 324
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8628 11 324
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.8547 10 330
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8539 11 324
ID Description Score Start End Superfamily
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9452 9 119 3.40.50.300
af_P9WJW1_115_180_1.10.20.140 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9442 124 187 1.10.20.140
3ephA02 Mainly Alpha;Orthogonal Bundle;Histone, subunit A; 0.9313 148 187 1.10.20.140
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9277 11 122 3.40.50.300
2zm5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9133 11 325 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X0QW13-F1-model_v4 IPPT-domain-containing protein 0.9526 12 118 GO:0005524
GO:0005739
GO:0006400
GO:0052381
AF-A0A3D0N069-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9509 11 114 GO:0005524
GO:0006400
GO:0052381
AF-A0A2V6AYM6-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9338 10 138 GO:0005524
GO:0006400
GO:0052381
AF-A0A537IKN4-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9292 11 325 GO:0005524
GO:0006400
GO:0052381
AF-A0A329K4F9-F1-model_v4 tRNA (Adenosine(37)-N6)-dimethylallyltransferase MiaA 0.9235 10 130 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
89.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map