F128506

General Info

Members Datasets Scaffolds Average Seq Length
125 108 250 202

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221609|2644059443
Length 237
Sequence ILRTGAITAEIRKAQAAAAVAPTAKNAKQGAATKDKAAAAAAPKGAGEIRIIGGQWKRTRLPVAQRPGLRPTPDRVRETLFNWLGQDLTGWRCLDAFAGTGALGLEAASRGAAAVQLVESDAALVAQLHTLQQRLEARAVRVQRGDGIAALRQAAPGSLDLVLIDPPFDSKLFESALEAAGKAVAASGYVYLEAPVAWTDEGLAASGLVVYRHLKAGAVHAHLLRPVGAAAVPGEAG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
42 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
88 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
89 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
90 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
91 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
92 2643221609 Acidovorax sp. Root217 Isolate Unclassified
93 2547132374 Acidovorax radicis N35 Isolate Unclassified
94 2643221570 Acidovorax sp. Root568 Isolate Unclassified
95 2643221596 Acidovorax sp. Root70 Isolate Unclassified
96 2643221611 Acidovorax sp. Root219 Isolate Unclassified
97 2643221652 Acidovorax sp. Root402 Isolate Unclassified
98 2643221660 Methylibium sp. Root1272 Isolate Unclassified
99 2643221717 Acidovorax sp. Root267 Isolate Unclassified
100 2721755523 Delftia sp. HK171 Isolate Unclassified
101 2738543012 Acidovorax sp. CF301 Isolate Unclassified
102 2816332133 Acidovorax radicis 2721A Isolate Unclassified
103 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
104 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
105 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
106 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
107 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
108 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 2.4
Rhizoplane 0.8
Rhizosphere 68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10023451 3300005328 Bacteria 3469
2 Ga0068868_100024967 3300005338 Bacteria 4540
3 Ga0070673_100468970 3300005364 Bacteria 1135
4 Ga0070667_100332986 3300005367 Bacteria 1372
5 Ga0070662_100001973 3300005457 Bacteria 12604
6 Ga0068867_100053962 3300005459 Bacteria 2969
7 Ga0068853_100212497 3300005539 Bacteria 1764
8 Ga0068852_100215482 3300005616 Bacteria 1824
9 Ga0068860_100115605 3300005843 Bacteria 2566
10 Ga0068860_100325481 3300005843 Bacteria 1509
11 Ga0075367_10001893 3300006178 Bacteria 9269
12 Ga0075366_10013712 3300006195 Bacteria 4619
13 Ga0075366_10052783 3300006195 Bacteria 2415
14 Ga0075366_10057988 3300006195 Bacteria 2300
15 Ga0075366_10090199 3300006195 Bacteria 1835
16 Ga0075370_10060358 3300006353 Bacteria 2160
17 Ga0075370_10239893 3300006353 Bacteria 1073
18 Ga0079104_1000072 3300006946 Bacteria 152567
19 Ga0105250_10000407 3300009092 Bacteria 31544
20 Ga0105240_10011702 3300009093 Bacteria 12192
21 Ga0105243_10000626 3300009148 Bacteria 35234
22 Ga0105242_10003001 3300009176 Bacteria 13205
23 Ga0105237_10001363 3300009545 Bacteria 32325
24 Ga0105238_10065404 3300009551 Bacteria 3637
25 Ga0105239_10000954 3300010375 Bacteria 40769
26 Ga0157317_1000742 3300012475 Bacteria 1547
27 Ga0163161_10855981 3300017792 Bacteria 767
28 Ga0207696_1031077 3300025711 Bacteria 1617
29 Ga0207645_10064272 3300025907 Bacteria 2345
30 Ga0207684_10004795 3300025910 Bacteria 12670
31 Ga0207695_10065644 3300025913 Bacteria 3731
32 Ga0207671_10006057 3300025914 Bacteria 10906
33 Ga0207644_10293225 3300025931 Bacteria 1309
34 Ga0207706_10005101 3300025933 Bacteria 12262
35 Ga0207686_10004933 3300025934 Bacteria 7181
36 Ga0207709_10000104 3300025935 Bacteria 130964
37 Ga0207639_10017242 3300026041 Bacteria 5119
38 Ga0207678_10236794 3300026067 Bacteria 1563
39 Ga0207648_10026553 3300026089 Bacteria 5144
40 Ga0207683_10378542 3300026121 Bacteria 1301
41 Ga0207698_10389173 3300026142 Bacteria 1329
42 Ga0209281_1000002 3300027111 Bacteria 1924012
43 Ga0268264_10020417 3300028381 Bacteria 5414
44 Ga0307517_10182085 3300028786 Bacteria 1354
45 Ga0307515_10000011 3300028794 Bacteria 633903
46 Ga0265330_10000110 3300031235 Bacteria 68461
47 Ga0265332_10000011 3300031238 Bacteria 284299
48 Ga0265325_10006575 3300031241 Bacteria 7045
49 Ga0265340_10036718 3300031247 Bacteria 2428
50 Ga0265327_10076681 3300031251 Bacteria 1661
51 Ga0307408_100118945 3300031548 Bacteria 2044
52 Ga0265314_10000026 3300031711 Bacteria 284299
53 Ga0307516_10023280 3300031730 Bacteria 6354
54 Ga0307410_10118053 3300031852 Bacteria 1930
55 Ga0307416_101112979 3300032002 Bacteria 894
56 Ga0307416_101132869 3300032002 Bacteria 887
57 Ga0395900_0000183 3300037418 Bacteria 100749
58 Ga0395898_0012246 3300037466 Bacteria 8867
59 Ga0395905_0004208 3300037471 Bacteria 15056
60 Ga0395905_0102512 3300037471 Bacteria 2686
61 Ga0436361_0110525 3300039447 Bacteria 45343
62 Ga0451804_0090889 3300041463 Bacteria 818
63 Ga0439449_0172717 3300042007 Bacteria 807
64 Ga0451577_0044841 3300042876 Bacteria 3957
65 Ga0451577_0126997 3300042876 Bacteria 2285
66 Ga0466969_0000020 3300044656 Bacteria 101861
67 Ga0453683_0003653 3300044673 Bacteria 11274
68 Ga0466965_0019974 3300044683 Bacteria 3217
69 Ga0466965_0082018 3300044683 Bacteria 1631
70 Ga0466961_0010837 3300044693 Bacteria 5821
71 Ga0466961_0013801 3300044693 Bacteria 5177
72 Ga0466963_0006323 3300044694 Bacteria 7003
73 Ga0453684_0018472 3300044712 Bacteria 10699
74 Ga0466971_0005943 3300044719 Bacteria 5309
75 Ga0466970_0124981 3300044765 Bacteria 1410
76 Ga0466970_0125056 3300044765 Bacteria 1410
77 Ga0466957_0082158 3300044842 Bacteria 2008
78 Ga0466960_0090831 3300044901 Bacteria 1556
79 Ga0466959_0000424 3300045049 Bacteria 24579
80 Ga0466959_0096480 3300045049 Bacteria 2119
81 Ga0451576_0017813 3300045051 Bacteria 7802
82 Ga0466958_0103154 3300045836 Bacteria 1775
83 Ga0495590_0003374 3300046457 Bacteria 6533
84 Ga0495606_0194612 3300046507 Bacteria 1160
85 Ga0495643_0166114 3300046522 Bacteria 1082
86 Ga0495633_0001315 3300046558 Bacteria 19614
87 Ga0495686_0175511 3300047472 Bacteria 1244
88 Ga0496121_0006394 3300048924 Bacteria 14650
89 Ga0496121_0020087 3300048924 Bacteria 6636
90 Ga0496123_0205897 3300048926 Bacteria 1004
91 Ga0496125_0021187 3300048928 Bacteria 6072
92 Ga0496125_0031774 3300048928 Bacteria 4699
93 Ga0501036_0424332 3300049572 Bacteria 1109
94 Ga0501040_0676323 3300049576 Bacteria 746
95 Ga0501043_0000002 3300049579 Bacteria 351081
96 Ga0501046_0000008 3300049580 Bacteria 351167
97 Ga0501047_0000003 3300049581 Bacteria 508375
98 Ga0501048_0055858 3300049582 Bacteria 2802
99 Ga0501044_0173108 3300049823 Bacteria 2129
100 Ga0501045_0002874 3300049824 Bacteria 11770
101 nmdc:mga0k408_119860_c1 3300050493 Bacteria 1558
102 nmdc:mga0k408_217497_c1 3300050493 Bacteria 1141
103 nmdc:mga0k408_241693_c1 3300050493 Bacteria 1078
104 nmdc:mga0k408_73079_c1 3300050493 Bacteria 2003
105 nmdc:mga07m45_157598_c1 3300050496 Bacteria 1318
106 Ga0500607_047273 3300053121 Bacteria 2304
107 Ga0500652_076231 3300053131 Bacteria 1394
108 Ga0500634_0202190 3300053161 Bacteria 871
109 2644059443 2643221609 Bacteria 6756331
110 2548499619 2547132374 Bacteria 5530232
111 2643867108 2643221570 Bacteria 5103772
112 2643990045 2643221596 Bacteria 5006805
113 2644074280 2643221611 Bacteria 6820941
114 2644295529 2643221652 Bacteria 5140275
115 2644338572 2643221660 Bacteria 4208257
116 2644645063 2643221717 Bacteria 5676132
117 2722885460 2721755523 Bacteria 6430384
118 2739240971 2738543012 Bacteria 7115078
119 2816471951 2816332133 Bacteria 7249298
120 2839140346 2839138175 Bacteria 6549354
121 2842718591 2842718218 Bacteria 4560148
122 2894027204 2894023352 Bacteria 5167372
123 2932424861 2932422444 Bacteria 4678430
124 2974320524 2974320154 Bacteria 4571377
125 2990711297 2990710928 Bacteria 5002431
126 Ga0070676_10023451
127 Ga0068868_100024967
128 Ga0070673_100468970
129 Ga0070667_100332986
130 Ga0070662_100001973
131 Ga0068867_100053962
132 Ga0068853_100212497
133 Ga0068852_100215482
134 Ga0068860_100115605
135 Ga0068860_100325481
136 Ga0075367_10001893
137 Ga0075366_10013712
138 Ga0075366_10052783
139 Ga0075366_10057988
140 Ga0075366_10090199
141 Ga0075370_10060358
142 Ga0075370_10239893
143 Ga0079104_1000072
144 Ga0105250_10000407
145 Ga0105240_10011702
146 Ga0105243_10000626
147 Ga0105242_10003001
148 Ga0105237_10001363
149 Ga0105238_10065404
150 Ga0105239_10000954
151 Ga0157317_1000742
152 Ga0163161_10855981
153 Ga0207696_1031077
154 Ga0207645_10064272
155 Ga0207684_10004795
156 Ga0207695_10065644
157 Ga0207671_10006057
158 Ga0207644_10293225
159 Ga0207706_10005101
160 Ga0207686_10004933
161 Ga0207709_10000104
162 Ga0207639_10017242
163 Ga0207678_10236794
164 Ga0207648_10026553
165 Ga0207683_10378542
166 Ga0207698_10389173
167 Ga0209281_1000002
168 Ga0268264_10020417
169 Ga0307517_10182085
170 Ga0307515_10000011
171 Ga0265330_10000110
172 Ga0265332_10000011
173 Ga0265325_10006575
174 Ga0265340_10036718
175 Ga0265327_10076681
176 Ga0307408_100118945
177 Ga0265314_10000026
178 Ga0307516_10023280
179 Ga0307410_10118053
180 Ga0307416_101112979
181 Ga0307416_101132869
182 Ga0395900_0000183
183 Ga0395898_0012246
184 Ga0395905_0004208
185 Ga0395905_0102512
186 Ga0436361_0110525
187 Ga0451804_0090889
188 Ga0439449_0172717
189 Ga0451577_0044841
190 Ga0451577_0126997
191 Ga0466969_0000020
192 Ga0453683_0003653
193 Ga0466965_0019974
194 Ga0466965_0082018
195 Ga0466961_0010837
196 Ga0466961_0013801
197 Ga0466963_0006323
198 Ga0453684_0018472
199 Ga0466971_0005943
200 Ga0466970_0124981
201 Ga0466970_0125056
202 Ga0466957_0082158
203 Ga0466960_0090831
204 Ga0466959_0000424
205 Ga0466959_0096480
206 Ga0451576_0017813
207 Ga0466958_0103154
208 Ga0495590_0003374
209 Ga0495606_0194612
210 Ga0495643_0166114
211 Ga0495633_0001315
212 Ga0495686_0175511
213 Ga0496121_0006394
214 Ga0496121_0020087
215 Ga0496123_0205897
216 Ga0496125_0021187
217 Ga0496125_0031774
218 Ga0501036_0424332
219 Ga0501040_0676323
220 Ga0501043_0000002
221 Ga0501046_0000008
222 Ga0501047_0000003
223 Ga0501048_0055858
224 Ga0501044_0173108
225 Ga0501045_0002874
226 nmdc:mga0k408_119860_c1
227 nmdc:mga0k408_217497_c1
228 nmdc:mga0k408_241693_c1
229 nmdc:mga0k408_73079_c1
230 nmdc:mga07m45_157598_c1
231 Ga0500607_047273
232 Ga0500652_076231
233 Ga0500634_0202190
234 2644059443
235 2548499619
236 2643867108
237 2643990045
238 2644074280
239 2644295529
240 2644338572
241 2644645063
242 2722885460
243 2739240971
244 2816471951
245 2839140346
246 2842718591
247 2894027204
248 2932424861
249 2974320524
250 2990711297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

49

225

0.88

PF05175

MTS

Methyltransferase small domain

71

193

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.902 12 192
2fpo-assembly1.cif.gz_A putative methyltransferase yhhf from escherichia coli. 0.8933 12 191
2fpo-assembly4.cif.gz_D putative methyltransferase yhhf from escherichia coli. 0.8878 12 192
2fpo-assembly5.cif.gz_E putative methyltransferase yhhf from escherichia coli. 0.8845 12 191
2fpo-assembly6.cif.gz_F putative methyltransferase yhhf from escherichia coli. 0.884 12 191
ID Description Score Start End Superfamily
2fpoF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8828 12 191 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8803 52 116 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.878 37 194 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8727 37 194 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8727 12 190 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A258LA41-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9706 12 136 GO:0003676
GO:0008168
GO:0031167
AF-A0A7X3WMK3-F1-model_v4 Methyltransferase 0.9607 12 114 GO:0008168
GO:0031167
AF-D0S080-F1-model_v4 deleted 0.9558 12 190
AF-A0A1Z9HNV7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9545 12 95 GO:0008168
GO:0031167
AF-C4KDP6-F1-model_v4 Methyltransferase (EC 2.1.1.171) 0.9544 12 192 GO:0003676
GO:0052913

Map