F128367

General Info

Members Datasets Scaffolds Average Seq Length
125 78 250 351

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000182|Ga0500583_0000182_19433_20611
Length 384
Sequence MRNEKLKTEKLKSEIQELPGWRSNHKHKKQQQQQLQHLIDNKTKPLGALGRLEEVALQIGLIQQTTKPVIQHPHIIVFAGDHGIAKTGLVNAFPQEVTAQMVLNFLHGGAAINVFCRQNKLTLKVVDAGVNFDFTSAPADLIPAKVGYGTKNYLEEPAMSVAEAKQAIEKGRAIIKQIAAAGCNCIGFGEMGIGNTSSAALIMSAITGLPVVSFTGRGAGLNNEQLQTKIDTLHEVYEKHSLNELKEQPIELLARIGGFEIAMMAGAYLEAVKQKMIVLVDGFITTAAVLIANAIFISEEQPSLVPGWTTLIDHCIFAHTSQEAGHEKILQRLGVKPLLNLSMRLGEGTGAALAMPLIQSAVAFLNEMASFESAGVSNKDTQNA

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
65 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
66 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
67 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
71 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
72 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
73 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
74 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
75 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
76 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
77 2738541278 Niastella sp. CF465 Isolate Unclassified
78 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 0
Rhizosphere 81.6
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0000182 3300053092 Bacteria 25516
2 rootH1_10001457 3300003316 Bacteria 3827
3 rootH2_10014806 3300003320 Bacteria 14797
4 rootH2_10022930 3300003320 Bacteria 32910
5 rootH2_10077395 3300003320 Bacteria 4121
6 rootL2_10110477 3300003322 Bacteria 3860
7 rootH1_10040060 3300003323 Bacteria 9733
8 rootH1_10091995 3300003323 Bacteria 5269
9 Ga0070683_100166873 3300005329 Bacteria 2089
10 Ga0070681_10037275 3300005458 Bacteria 4880
11 Ga0070681_10084183 3300005458 Bacteria 3133
12 Ga0068853_100003470 3300005539 Bacteria 12058
13 Ga0068855_100002264 3300005563 Bacteria 23750
14 Ga0068855_100008070 3300005563 Bacteria 12721
15 Ga0068855_100050558 3300005563 Bacteria 4898
16 Ga0068857_100220785 3300005577 Bacteria 1731
17 Ga0068854_100018175 3300005578 Bacteria 4716
18 Ga0068856_100121629 3300005614 Bacteria 2612
19 Ga0068860_100002498 3300005843 Bacteria 19303
20 Ga0081540_1009720 3300005983 Bacteria 6597
21 Ga0068871_100039189 3300006358 Bacteria 3790
22 Ga0105240_10000198 3300009093 Bacteria 122388
23 Ga0105240_10001601 3300009093 Bacteria 38423
24 Ga0105240_10001632 3300009093 Bacteria 38064
25 Ga0105240_10004563 3300009093 Bacteria 21012
26 Ga0105240_10008810 3300009093 Bacteria 14371
27 Ga0105240_10049863 3300009093 Bacteria 5280
28 Ga0114129_10015468 3300009147 Bacteria 10851
29 Ga0105241_10005347 3300009174 Bacteria 9486
30 Ga0105241_10039363 3300009174 Bacteria 3566
31 Ga0105237_10000191 3300009545 Bacteria 87065
32 Ga0105237_10000938 3300009545 Bacteria 39240
33 Ga0105237_10002585 3300009545 Bacteria 22321
34 Ga0105237_10014504 3300009545 Bacteria 8237
35 Ga0105237_10114427 3300009545 Bacteria 2690
36 Ga0105238_10034769 3300009551 Bacteria 5126
37 Ga0105238_10035619 3300009551 Bacteria 5059
38 Ga0105239_10000019 3300010375 Bacteria 273836
39 Ga0105239_10001183 3300010375 Bacteria 35762
40 Ga0105239_10001681 3300010375 Bacteria 29165
41 Ga0105239_10003962 3300010375 Bacteria 17939
42 Ga0105239_10549017 3300010375 Bacteria 1316
43 Ga0157370_10128006 3300013104 Unclassified 2370
44 Ga0157374_10000011 3300013296 Bacteria 466749
45 Ga0157378_10018255 3300013297 Bacteria 6157
46 Ga0163162_10013498 3300013306 Bacteria 7974
47 Ga0157372_10002898 3300013307 Bacteria 18549
48 Ga0157372_10049886 3300013307 Bacteria 4656
49 Ga0163163_10151294 3300014325 Unclassified 2364
50 Ga0157376_10008358 3300014969 Bacteria 7465
51 Ga0157376_10178858 3300014969 Bacteria 1937
52 Ga0163161_10065036 3300017792 Bacteria 2661
53 Ga0207688_10012085 3300025901 Bacteria 4696
54 Ga0207707_10040819 3300025912 Bacteria 4052
55 Ga0207707_10202018 3300025912 Bacteria 1733
56 Ga0207695_10000212 3300025913 Bacteria 156450
57 Ga0207695_10001109 3300025913 Bacteria 46822
58 Ga0207695_10001527 3300025913 Bacteria 38268
59 Ga0207695_10004031 3300025913 Bacteria 20219
60 Ga0207695_10049720 3300025913 Bacteria 4416
61 Ga0207695_10061778 3300025913 Bacteria 3871
62 Ga0207695_10188449 3300025913 Bacteria 1981
63 Ga0207671_10000402 3300025914 Bacteria 60371
64 Ga0207671_10002405 3300025914 Bacteria 20073
65 Ga0207671_10006933 3300025914 Bacteria 9977
66 Ga0207671_10018656 3300025914 Bacteria 5316
67 Ga0207694_10035064 3300025924 Bacteria 3848
68 Ga0207661_10148796 3300025944 Bacteria 2022
69 Ga0207667_10000414 3300025949 Bacteria 57815
70 Ga0207667_10038967 3300025949 Bacteria 5068
71 Ga0207667_10106495 3300025949 Bacteria 2892
72 Ga0207640_10078643 3300025981 Unclassified 2246
73 Ga0207639_10001831 3300026041 Bacteria 14322
74 Ga0207702_10071398 3300026078 Bacteria 2990
75 Ga0207674_10121763 3300026116 Bacteria 2576
76 Ga0268264_10005301 3300028381 Bacteria 10920
77 Ga0307517_10000501 3300028786 Bacteria 67241
78 Ga0307515_10162541 3300028794 Bacteria 2269
79 Ga0307511_10000211 3300030521 Bacteria 59246
80 Ga0307509_10102475 3300031507 Bacteria 2894
81 Ga0307509_10142955 3300031507 Bacteria 2324
82 Ga0307508_10000518 3300031616 Bacteria 46205
83 Ga0307516_10002386 3300031730 Bacteria 25156
84 Ga0307516_10082766 3300031730 Bacteria 3051
85 Ga0307510_10001606 3300033180 Bacteria 25001
86 Ga0439436_0007542 3300041404 Bacteria 3348
87 Ga0439449_0065972 3300042007 Bacteria 1335
88 Ga0439457_002830 3300042014 Bacteria 4845
89 Ga0439462_0002758 3300042015 Bacteria 4125
90 Ga0451577_0010739 3300042876 Bacteria 8717
91 Ga0451577_0072438 3300042876 Bacteria 3073
92 Ga0466969_0039442 3300044656 Bacteria 2372
93 Ga0466972_0000026 3300044658 Bacteria 184739
94 Ga0466972_0000047 3300044658 Bacteria 122901
95 Ga0466972_0002405 3300044658 Bacteria 9228
96 Ga0466966_0000038 3300044684 Bacteria 97255
97 Ga0466964_0037103 3300044706 Bacteria 1957
98 Ga0453684_0000158 3300044712 Bacteria 302033
99 Ga0453684_0099324 3300044712 Bacteria 3565
100 Ga0466970_0003659 3300044765 Bacteria 7503
101 Ga0466970_0147546 3300044765 Unclassified 1298
102 Ga0466957_0000739 3300044842 Bacteria 16704
103 Ga0466957_0005377 3300044842 Bacteria 7188
104 Ga0466959_0000421 3300045049 Bacteria 24705
105 Ga0466959_0015385 3300045049 Bacteria 5571
106 Ga0451576_0002356 3300045051 Bacteria 28493
107 Ga0451576_0018430 3300045051 Bacteria 7652
108 Ga0495606_0003846 3300046507 Bacteria 15506
109 Ga0495611_0000174 3300046648 Bacteria 46643
110 Ga0495672_0023247 3300047320 Bacteria 4016
111 Ga0495686_0000005 3300047472 Bacteria 827143
112 Ga0501043_0298720 3300049579 Bacteria 1231
113 Ga0501219_000020 3300049703 Bacteria 25032
114 Ga0501044_0092923 3300049823 Bacteria 3042
115 Ga0501044_0328764 3300049823 Bacteria 1452
116 Ga0501284_00030 3300050005 Bacteria 71858
117 nmdc:mga05p37_10942_c1 3300050507 Bacteria 10772
118 Ga0500578_0000469 3300053086 Bacteria 49263
119 Ga0500583_0001941 3300053092 Bacteria 6072
120 Ga0500658_0033169 3300053134 Unclassified 2029
121 Ga0500588_0011399 3300053146 Bacteria 2175
122 Ga0500616_0012896 3300053153 Bacteria 4871
123 Ga0466962_0075093 3300061719 Bacteria 1615
124 2738725846 2738541278 Bacteria 9755573
125 2883071785 2883068021 Bacteria 6192739
126 Ga0500583_0000182
127 rootH1_10001457
128 rootH2_10014806
129 rootH2_10022930
130 rootH2_10077395
131 rootL2_10110477
132 rootH1_10040060
133 rootH1_10091995
134 Ga0070683_100166873
135 Ga0070681_10037275
136 Ga0070681_10084183
137 Ga0068853_100003470
138 Ga0068855_100002264
139 Ga0068855_100008070
140 Ga0068855_100050558
141 Ga0068857_100220785
142 Ga0068854_100018175
143 Ga0068856_100121629
144 Ga0068860_100002498
145 Ga0081540_1009720
146 Ga0068871_100039189
147 Ga0105240_10000198
148 Ga0105240_10001601
149 Ga0105240_10001632
150 Ga0105240_10004563
151 Ga0105240_10008810
152 Ga0105240_10049863
153 Ga0114129_10015468
154 Ga0105241_10005347
155 Ga0105241_10039363
156 Ga0105237_10000191
157 Ga0105237_10000938
158 Ga0105237_10002585
159 Ga0105237_10014504
160 Ga0105237_10114427
161 Ga0105238_10034769
162 Ga0105238_10035619
163 Ga0105239_10000019
164 Ga0105239_10001183
165 Ga0105239_10001681
166 Ga0105239_10003962
167 Ga0105239_10549017
168 Ga0157370_10128006
169 Ga0157374_10000011
170 Ga0157378_10018255
171 Ga0163162_10013498
172 Ga0157372_10002898
173 Ga0157372_10049886
174 Ga0163163_10151294
175 Ga0157376_10008358
176 Ga0157376_10178858
177 Ga0163161_10065036
178 Ga0207688_10012085
179 Ga0207707_10040819
180 Ga0207707_10202018
181 Ga0207695_10000212
182 Ga0207695_10001109
183 Ga0207695_10001527
184 Ga0207695_10004031
185 Ga0207695_10049720
186 Ga0207695_10061778
187 Ga0207695_10188449
188 Ga0207671_10000402
189 Ga0207671_10002405
190 Ga0207671_10006933
191 Ga0207671_10018656
192 Ga0207694_10035064
193 Ga0207661_10148796
194 Ga0207667_10000414
195 Ga0207667_10038967
196 Ga0207667_10106495
197 Ga0207640_10078643
198 Ga0207639_10001831
199 Ga0207702_10071398
200 Ga0207674_10121763
201 Ga0268264_10005301
202 Ga0307517_10000501
203 Ga0307515_10162541
204 Ga0307511_10000211
205 Ga0307509_10102475
206 Ga0307509_10142955
207 Ga0307508_10000518
208 Ga0307516_10002386
209 Ga0307516_10082766
210 Ga0307510_10001606
211 Ga0439436_0007542
212 Ga0439449_0065972
213 Ga0439457_002830
214 Ga0439462_0002758
215 Ga0451577_0010739
216 Ga0451577_0072438
217 Ga0466969_0039442
218 Ga0466972_0000026
219 Ga0466972_0000047
220 Ga0466972_0002405
221 Ga0466966_0000038
222 Ga0466964_0037103
223 Ga0453684_0000158
224 Ga0453684_0099324
225 Ga0466970_0003659
226 Ga0466970_0147546
227 Ga0466957_0000739
228 Ga0466957_0005377
229 Ga0466959_0000421
230 Ga0466959_0015385
231 Ga0451576_0002356
232 Ga0451576_0018430
233 Ga0495606_0003846
234 Ga0495611_0000174
235 Ga0495672_0023247
236 Ga0495686_0000005
237 Ga0501043_0298720
238 Ga0501219_000020
239 Ga0501044_0092923
240 Ga0501044_0328764
241 Ga0501284_00030
242 nmdc:mga05p37_10942_c1
243 Ga0500578_0000469
244 Ga0500583_0001941
245 Ga0500658_0033169
246 Ga0500588_0011399
247 Ga0500616_0012896
248 Ga0466962_0075093
249 2738725846
250 2883071785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02277

DBI_PRT

Phosphoribosyltransferase

25

376

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kqi-assembly1.cif.gz_A-2 crystal structure of cobt e317a complexed with its reaction products 0.9455 5 344
6b5f-assembly1.cif.gz_A crystal structure of nicotinate mononucleotide-5,6-dimethylbenzimidazole phosphoribosyltransferase cobt from yersinia enterocolitica 0.9443 5 344
4kqg-assembly1.cif.gz_A crystal structure of cobt e174a complexed with dmb 0.9433 5 351
1jh8-assembly1.cif.gz_A structural investigation of the biosynthesis of alternative lower ligands for cobamides by nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (cobt) from salmonella enterica 0.943 5 351
4kqh-assembly1.cif.gz_A-2 crystal structure of cobt e317a 0.9428 5 344
ID Description Score Start End Superfamily
1j33A01 Mainly Alpha;Orthogonal Bundle;5,6-Dimethylbenzimidazole Phosphoribosyltransferase; Chain: A; domain 1;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), small domain 0.9523 5 42 1.10.1610.10
1d0sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9507 46 332 3.40.50.10210
af_P9WP85_55_326_3.40.50.10210 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9373 45 332 3.40.50.10210
1d0sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9371 46 332 3.40.50.10210
1wx1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.931 44 332 3.40.50.10210
ID Description Score Start End GO Terms
AF-A0A350CUG1-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (NN:DBI PRT) (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.977 5 352 GO:0008939
GO:0009236
AF-A0A292YQM2-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (NN:DBI PRT) (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.9761 5 352 GO:0008939
GO:0009236
GO:0016491
AF-A0A5C8A2N5-F1-model_v4 deleted 0.9757 5 357
AF-A0A2R4C712-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (NN:DBI PRT) (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.9748 5 352 GO:0008939
GO:0009236
AF-A0A1Y6C7J6-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (NN:DBI PRT) (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.9748 4 352 GO:0008939
GO:0009236

Map