F127683

General Info

Members Datasets Scaffolds Average Seq Length
125 94 250 120

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1532821|Ga0451576_1532821_78_563
Length 145
Sequence MIRGLHGLFYSSEPEAMRAFMRDKLRLPFSDVGEGWLIFDLPEGDVGVHPTEDSGGTPAGTHDVSFYCDDIQGTVADLKSRGVPFKGEIEDHGYGMVTYFTMPGGVEVQLYEPRYKKSTAQARPSARGPRAVRKARRVARVKKRR

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
84 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 0
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 28.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1532821 3300045051 Unclassified 692
2 Ga0055531_10000051 3300003794 Bacteria 130125
3 Ga0068868_101983704 3300005338 Unclassified 552
4 Ga0070689_100068888 3300005340 Bacteria 2760
5 Ga0070687_100058972 3300005343 Bacteria 2019
6 Ga0070668_100331179 3300005347 Bacteria 1284
7 Ga0070668_101616064 3300005347 Bacteria 594
8 Ga0070675_101842326 3300005354 Unclassified 558
9 Ga0070700_101946312 3300005441 Bacteria 509
10 Ga0070708_100446232 3300005445 Bacteria 1220
11 Ga0070708_101749573 3300005445 Archaea 577
12 Ga0068867_100721997 3300005459 Bacteria 881
13 Ga0068867_101936429 3300005459 Unclassified 556
14 Ga0070685_10000302 3300005466 Bacteria 31231
15 Ga0070706_100001095 3300005467 Bacteria 29274
16 Ga0070707_100058476 3300005468 Unclassified 3697
17 Ga0070707_100060923 3300005468 Archaea 3619
18 Ga0070698_100902837 3300005471 Bacteria 829
19 Ga0070698_101872081 3300005471 Unclassified 553
20 Ga0074259_10015096 3300005507 Unclassified 511
21 Ga0070699_100828363 3300005518 Bacteria 847
22 Ga0070699_101947367 3300005518 Bacteria 537
23 Ga0070697_100022427 3300005536 Archaea 5011
24 Ga0070697_100286684 3300005536 Bacteria 1414
25 Ga0070686_100187964 3300005544 Bacteria 1472
26 Ga0070686_100460165 3300005544 Bacteria 980
27 Ga0070665_102614532 3300005548 Unclassified 505
28 Ga0068859_100808244 3300005617 Unclassified 1025
29 Ga0068859_101568167 3300005617 Bacteria 727
30 Ga0068861_101352965 3300005719 Unclassified 694
31 Ga0068861_101934784 3300005719 Bacteria 587
32 Ga0068858_100511232 3300005842 Unclassified 1161
33 Ga0068862_100006025 3300005844 Bacteria 10096
34 Ga0068862_101989623 3300005844 Bacteria 592
35 Ga0081455_10330220 3300005937 Bacteria 1083
36 Ga0070715_10042826 3300006163 Unclassified 1905
37 Ga0097621_100092437 3300006237 Bacteria 2534
38 Ga0097621_100197864 3300006237 Bacteria 1743
39 Ga0075428_100035072 3300006844 Bacteria 5530
40 Ga0075428_100129303 3300006844 Bacteria 2748
41 Ga0075428_101170957 3300006844 Unclassified 811
42 Ga0075430_100182515 3300006846 Bacteria 1745
43 Ga0075431_100261441 3300006847 Bacteria 1756
44 Ga0075433_11288504 3300006852 Bacteria 633
45 Ga0075429_100018615 3300006880 Bacteria 6015
46 Ga0075429_100129614 3300006880 Bacteria 2206
47 Ga0097620_100808142 3300006931 Unclassified 1025
48 Ga0097620_101567866 3300006931 Bacteria 727
49 Ga0075435_100143239 3300007076 Bacteria 2006
50 Ga0111539_10006640 3300009094 Bacteria 14904
51 Ga0111539_10943517 3300009094 Unclassified 1003
52 Ga0111539_11002699 3300009094 Bacteria 971
53 Ga0111539_11839485 3300009094 Unclassified 702
54 Ga0105245_10033425 3300009098 Unclassified 4559
55 Ga0105247_10362247 3300009101 Bacteria 1023
56 Ga0105242_10001945 3300009176 Bacteria 16253
57 Ga0105248_10226193 3300009177 Bacteria 2106
58 Ga0105239_12588248 3300010375 Unclassified 592
59 Ga0163163_10513202 3300014325 Bacteria 1261
60 Ga0157380_10014495 3300014326 Bacteria 5768
61 Ga0157380_11942880 3300014326 Bacteria 649
62 Ga0157376_10164803 3300014969 Bacteria 2013
63 Ga0157376_12041296 3300014969 Bacteria 611
64 Ga0209050_1010080 3300025298 Bacteria 4712
65 Ga0209051_1003868 3300025303 Bacteria 9569
66 Ga0209257_1000017 3300025304 Bacteria 866287
67 Ga0207684_10008591 3300025910 Bacteria 9080
68 Ga0207662_10196528 3300025918 Bacteria 1304
69 Ga0207646_10174319 3300025922 Bacteria 1942
70 Ga0207646_10489721 3300025922 Unclassified 1108
71 Ga0207686_10001611 3300025934 Bacteria 12644
72 Ga0207670_10025448 3300025936 Unclassified 3715
73 Ga0207665_10362533 3300025939 Bacteria 1096
74 Ga0207711_10107333 3300025941 Unclassified 2479
75 Ga0207668_10421647 3300025972 Bacteria 1133
76 Ga0207708_11632779 3300026075 Unclassified 566
77 Ga0207641_10505367 3300026088 Bacteria 1174
78 Ga0207648_10937238 3300026089 Bacteria 810
79 Ga0207648_11603185 3300026089 Unclassified 612
80 Ga0207675_102158715 3300026118 Bacteria 573
81 Ga0207683_12147995 3300026121 Bacteria 506
82 Ga0209971_1045859 3300027682 Bacteria 1054
83 Ga0207428_10056042 3300027907 Bacteria 3132
84 Ga0268265_10000496 3300028380 Bacteria 40862
85 Ga0268265_10223016 3300028380 Bacteria 1651
86 Ga0268265_10943845 3300028380 Bacteria 849
87 Ga0268265_11736324 3300028380 Bacteria 630
88 Ga0268264_12375446 3300028381 Bacteria 536
89 Ga0307409_100428938 3300031995 Bacteria 1270
90 Ga0307415_101146221 3300032126 Unclassified 730
91 Ga0373943_0316549 3300035170 Unclassified 889
92 Ga0439452_057312 3300042010 Bacteria 879
93 Ga0439462_0119581 3300042015 Bacteria 732
94 Ga0450890_012318 3300042127 Bacteria 1109
95 Ga0453684_2200103 3300044712 Unclassified 551
96 Ga0451576_1927432 3300045051 Unclassified 609
97 Ga0495592_0932911 3300046454 Unclassified 509
98 Ga0495641_0409779 3300046461 Unclassified 615
99 Ga0495586_0151015 3300046535 Unclassified 1307
100 Ga0495587_0558895 3300046536 Bacteria 631
101 Ga0495656_0508034 3300046615 Bacteria 640
102 Ga0495588_0020991 3300046674 Bacteria 3215
103 Ga0495658_0044620 3300046683 Bacteria 2485
104 Ga0495684_0706251 3300047471 Unclassified 668
105 Ga0495615_0010136 3300048090 Bacteria 1874
106 Ga0501033_0827720 3300049570 Unclassified 625
107 Ga0501042_0689778 3300049578 Bacteria 743
108 Ga0501048_0630237 3300049582 Bacteria 770
109 Ga0501072_0296232 3300049588 Bacteria 1286
110 Ga0501202_208155 3300049652 Unclassified 537
111 Ga0501229_029032 3300049706 Unclassified 753
112 nmdc:mga09592_15615_c1 3300050508 Bacteria 6203
113 nmdc:mga09592_195022_c1 3300050508 Bacteria 1753
114 nmdc:mga0qj67_241568_c1 3300050509 Bacteria 1465
115 nmdc:mga06r32_249590_c1 3300050510 Bacteria 1762
116 nmdc:mga06r32_9491_c1 3300050510 Bacteria 8783
117 nmdc:mga08y16_1048350_c1 3300050511 Bacteria 793
118 nmdc:mga08y16_17072_c1 3300050511 Bacteria 7643
119 nmdc:mga08y16_673758_c1 3300050511 Unclassified 1036
120 nmdc:mga0rr50_144536_c1 3300050513 Bacteria 1916
121 nmdc:mga0a205_617966_c1 3300050515 Bacteria 936
122 Ga0495619_1183043 3300053085 Unclassified 507
123 Ga0500568_0054412 3300053139 Bacteria 1565
124 Ga0501082_1109305 3300060353 Bacteria 692
125 Ga0530510_0517469 3300061734 Bacteria 905
126 Ga0451576_1532821
127 Ga0055531_10000051
128 Ga0068868_101983704
129 Ga0070689_100068888
130 Ga0070687_100058972
131 Ga0070668_100331179
132 Ga0070668_101616064
133 Ga0070675_101842326
134 Ga0070700_101946312
135 Ga0070708_100446232
136 Ga0070708_101749573
137 Ga0068867_100721997
138 Ga0068867_101936429
139 Ga0070685_10000302
140 Ga0070706_100001095
141 Ga0070707_100058476
142 Ga0070707_100060923
143 Ga0070698_100902837
144 Ga0070698_101872081
145 Ga0074259_10015096
146 Ga0070699_100828363
147 Ga0070699_101947367
148 Ga0070697_100022427
149 Ga0070697_100286684
150 Ga0070686_100187964
151 Ga0070686_100460165
152 Ga0070665_102614532
153 Ga0068859_100808244
154 Ga0068859_101568167
155 Ga0068861_101352965
156 Ga0068861_101934784
157 Ga0068858_100511232
158 Ga0068862_100006025
159 Ga0068862_101989623
160 Ga0081455_10330220
161 Ga0070715_10042826
162 Ga0097621_100092437
163 Ga0097621_100197864
164 Ga0075428_100035072
165 Ga0075428_100129303
166 Ga0075428_101170957
167 Ga0075430_100182515
168 Ga0075431_100261441
169 Ga0075433_11288504
170 Ga0075429_100018615
171 Ga0075429_100129614
172 Ga0097620_100808142
173 Ga0097620_101567866
174 Ga0075435_100143239
175 Ga0111539_10006640
176 Ga0111539_10943517
177 Ga0111539_11002699
178 Ga0111539_11839485
179 Ga0105245_10033425
180 Ga0105247_10362247
181 Ga0105242_10001945
182 Ga0105248_10226193
183 Ga0105239_12588248
184 Ga0163163_10513202
185 Ga0157380_10014495
186 Ga0157380_11942880
187 Ga0157376_10164803
188 Ga0157376_12041296
189 Ga0209050_1010080
190 Ga0209051_1003868
191 Ga0209257_1000017
192 Ga0207684_10008591
193 Ga0207662_10196528
194 Ga0207646_10174319
195 Ga0207646_10489721
196 Ga0207686_10001611
197 Ga0207670_10025448
198 Ga0207665_10362533
199 Ga0207711_10107333
200 Ga0207668_10421647
201 Ga0207708_11632779
202 Ga0207641_10505367
203 Ga0207648_10937238
204 Ga0207648_11603185
205 Ga0207675_102158715
206 Ga0207683_12147995
207 Ga0209971_1045859
208 Ga0207428_10056042
209 Ga0268265_10000496
210 Ga0268265_10223016
211 Ga0268265_10943845
212 Ga0268265_11736324
213 Ga0268264_12375446
214 Ga0307409_100428938
215 Ga0307415_101146221
216 Ga0373943_0316549
217 Ga0439452_057312
218 Ga0439462_0119581
219 Ga0450890_012318
220 Ga0453684_2200103
221 Ga0451576_1927432
222 Ga0495592_0932911
223 Ga0495641_0409779
224 Ga0495586_0151015
225 Ga0495587_0558895
226 Ga0495656_0508034
227 Ga0495588_0020991
228 Ga0495658_0044620
229 Ga0495684_0706251
230 Ga0495615_0010136
231 Ga0501033_0827720
232 Ga0501042_0689778
233 Ga0501048_0630237
234 Ga0501072_0296232
235 Ga0501202_208155
236 Ga0501229_029032
237 nmdc:mga09592_15615_c1
238 nmdc:mga09592_195022_c1
239 nmdc:mga0qj67_241568_c1
240 nmdc:mga06r32_249590_c1
241 nmdc:mga06r32_9491_c1
242 nmdc:mga08y16_1048350_c1
243 nmdc:mga08y16_17072_c1
244 nmdc:mga08y16_673758_c1
245 nmdc:mga0rr50_144536_c1
246 nmdc:mga0a205_617966_c1
247 Ga0495619_1183043
248 Ga0500568_0054412
249 Ga0501082_1109305
250 Ga0530510_0517469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

110

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.8171 64 116
5znh-assembly1.cif.gz_A catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2 0.8115 62 111
5zsz-assembly1.cif.gz_A catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 0.8051 62 111
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7826 61 114
3hpy-assembly1.cif.gz_B crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol 0.7825 62 114
ID Description Score Start End Superfamily
5znhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8115 62 111 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7926 60 109 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.787 66 112 3.30.720.110
3hq0A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7816 64 114 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7728 62 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3D3JGP4-F1-model_v4 Extradiol dioxygenase 0.9801 1 116 GO:0051213
AF-A0A3D3JGP4-F1-model_v4 Extradiol dioxygenase 0.9718 1 116 GO:0051213
AF-A0A3E0QD29-F1-model_v4 VOC domain-containing protein 0.97 1 114
AF-A0A7W0VC67-F1-model_v4 VOC domain-containing protein 0.9633 1 116
AF-A0A538RZC7-F1-model_v4 VOC domain-containing protein 0.9579 1 116

Map