F126604

General Info

Members Datasets Scaffolds Average Seq Length
125 90 125 440

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10249485|Ga0157380_102494851
Length 463
Sequence MSTSRPFDPASALVQAPAAPAEVLIASAHVLDPRAGIDAPHDVLVRDGRIAEIGAPGSIAASPGAEVVDGRGRHLLPAFVDPHVHLRVPGQEHKEDIETGTRAAAAGGYCAVVAMPNTEPVVDSAPVLRSLRDAAARDARVAVGFMPAITRGLKGSELTEMAELRAEGALGFTDDGKPVVSAGMLRKALQYQRLAGGVIALHEEDPSLSGNGAMHEGAVSAMLGITGIPSISESTMVARDAAIAGYEGGRVHMQHLSCIESVRAVAQAKEIGVRVTAEASPHHLCLTDEAVRGGHAGPGLLDTNMKMNPPLRTEADRQALIDGLRAGVIDCIATDHAPHARDEKESPFEQAPMGTTGLETAFAAVHTELVVPGVLPLALVVDRMTAGAALLDLPVPRIEAGAPANLTLVDLAAEWDVGAGWAGRRHAGTSARSRWAMLPPATVRRTRPRSRRPAKQQFSERLS

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
55 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
59 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
60 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
64 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
87 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
88 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
89 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
90 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 28.8
Rhizosphere 69.6
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100005307 3300005338 Bacteria 9052
2 Ga0070660_100062194 3300005339 Bacteria 2900
3 Ga0070659_100035640 3300005366 Bacteria 3875
4 Ga0070713_100075918 3300005436 Bacteria 2852
5 Ga0070710_10024710 3300005437 Bacteria 3173
6 Ga0070711_100000367 3300005439 Bacteria 23337
7 Ga0070700_100036746 3300005441 Bacteria 2973
8 Ga0070707_100237281 3300005468 Bacteria 1775
9 Ga0070684_100237264 3300005535 Bacteria 1665
10 Ga0070696_100037620 3300005546 Bacteria 3339
11 Ga0070665_100001256 3300005548 Bacteria 30586
12 Ga0068857_100105706 3300005577 Bacteria 2528
13 Ga0068852_100164165 3300005616 Bacteria 2076
14 Ga0068864_100054605 3300005618 Bacteria 3448
15 Ga0068862_100049104 3300005844 Bacteria 3604
16 Ga0081455_10024445 3300005937 Bacteria 5594
17 Ga0081538_10000939 3300005981 Bacteria 31446
18 Ga0081538_10002183 3300005981 Bacteria 19421
19 Ga0081538_10068065 3300005981 Bacteria 1982
20 Ga0081540_1000366 3300005983 Bacteria 45428
21 Ga0081540_1000828 3300005983 Bacteria 28230
22 Ga0081539_10004991 3300005985 Bacteria 14029
23 Ga0081539_10012416 3300005985 Bacteria 6567
24 Ga0075364_10049672 3300006051 Bacteria 2737
25 Ga0075434_100007958 3300006871 Bacteria 9824
26 Ga0075434_100062641 3300006871 Bacteria 3702
27 Ga0068865_100069586 3300006881 Bacteria 2490
28 Ga0075436_100063678 3300006914 Bacteria 2548
29 Ga0075435_100096127 3300007076 Bacteria 2450
30 Ga0105245_10141405 3300009098 Bacteria 2267
31 Ga0105245_10227031 3300009098 Bacteria 1804
32 Ga0105249_10059197 3300009553 Bacteria 3513
33 Ga0157372_10126328 3300013307 Bacteria 2941
34 Ga0157375_10279213 3300013308 Bacteria 1833
35 Ga0157380_10249485 3300014326 Bacteria 1606
36 Ga0207642_10053842 3300025899 Bacteria 1832
37 Ga0207663_10002294 3300025916 Bacteria 9161
38 Ga0207663_10174112 3300025916 Bacteria 1531
39 Ga0207657_10077852 3300025919 Bacteria 2794
40 Ga0207646_10219268 3300025922 Bacteria 1719
41 Ga0207687_10101958 3300025927 Bacteria 2114
42 Ga0207709_10003922 3300025935 Bacteria 8687
43 Ga0207704_10015638 3300025938 Bacteria 3873
44 Ga0207704_10027564 3300025938 Bacteria 3137
45 Ga0207665_10020036 3300025939 Bacteria 4393
46 Ga0207689_10069883 3300025942 Bacteria 2885
47 Ga0207679_10100264 3300025945 Bacteria 2263
48 Ga0207668_10195096 3300025972 Bacteria 1608
49 Ga0268266_10004886 3300028379 Bacteria 12714
50 Ga0265318_10014657 3300028577 Bacteria 3286
51 Ga0265336_10000005 3300028666 Bacteria 399349
52 Ga0265338_10000001 3300028800 Bacteria 1177449
53 Ga0265338_10044773 3300028800 Bacteria 4079
54 Ga0265324_10006677 3300029957 Bacteria 4769
55 Ga0265340_10000001 3300031247 Bacteria 1647668
56 Ga0265327_10010027 3300031251 Bacteria 6732
57 Ga0265327_10013347 3300031251 Bacteria 5461
58 Ga0265316_10012453 3300031344 Bacteria 7627
59 Ga0265316_10105527 3300031344 Bacteria 2138
60 Ga0395900_0039639 3300037418 Bacteria 4853
61 Ga0395900_0129137 3300037418 Bacteria 2591
62 Ga0466966_0091788 3300044684 Bacteria 1885
63 Ga0466963_0000353 3300044694 Bacteria 20819
64 Ga0466958_0011514 3300045836 Bacteria 4982
65 Ga0466958_0136498 3300045836 Bacteria 1543
66 Ga0466967_0177625 3300045976 Bacteria 2006
67 Ga0495582_0125387 3300046473 Bacteria 1449
68 Ga0495664_0000012 3300046477 Bacteria 226118
69 Ga0495630_0079226 3300046517 Bacteria 2478
70 Ga0495645_0001598 3300046543 Bacteria 15333
71 Ga0495604_0000180 3300047317 Bacteria 56391
72 Ga0495684_0010634 3300047471 Bacteria 7111
73 Ga0496100_0011250 3300048903 Bacteria 5090
74 Ga0496100_0060529 3300048903 Bacteria 2492
75 Ga0496101_0025054 3300048904 Bacteria 4135
76 Ga0496101_0047253 3300048904 Bacteria 3089
77 Ga0496102_0000027 3300048905 Bacteria 225466
78 Ga0496102_0007810 3300048905 Bacteria 9147
79 Ga0496102_0086421 3300048905 Bacteria 2896
80 Ga0496102_0217424 3300048905 Bacteria 1801
81 Ga0496103_0000062 3300048906 Bacteria 129593
82 Ga0496104_0000026 3300048907 Bacteria 210098
83 Ga0496104_0008394 3300048907 Bacteria 9182
84 Ga0496104_0125431 3300048907 Bacteria 2465
85 Ga0496106_0011315 3300048909 Bacteria 6604
86 Ga0496106_0160529 3300048909 Bacteria 1777
87 Ga0496106_0207396 3300048909 Bacteria 1560
88 Ga0496107_0139972 3300048910 Bacteria 1788
89 Ga0496108_0001875 3300048911 Bacteria 16829
90 Ga0496108_0035469 3300048911 Bacteria 4146
91 Ga0496108_0055299 3300048911 Bacteria 3332
92 Ga0496109_0001110 3300048912 Bacteria 22328
93 Ga0496109_0018888 3300048912 Bacteria 6068
94 Ga0496110_0000183 3300048913 Bacteria 39196
95 Ga0496110_0021970 3300048913 Bacteria 5412
96 Ga0496111_0000006 3300048914 Bacteria 107643
97 Ga0496111_0027127 3300048914 Bacteria 4049
98 Ga0496111_0062068 3300048914 Bacteria 2710
99 Ga0496111_0069971 3300048914 Bacteria 2552
100 Ga0496112_0000139 3300048915 Bacteria 45072
101 Ga0496112_0021036 3300048915 Bacteria 6197
102 Ga0496112_0213209 3300048915 Bacteria 1888
103 Ga0496113_0004250 3300048916 Bacteria 8771
104 Ga0496113_0058515 3300048916 Bacteria 2900
105 Ga0496114_0101481 3300048917 Bacteria 2457
106 Ga0496114_0213015 3300048917 Bacteria 1695
107 Ga0496115_0000222 3300048918 Bacteria 52327
108 Ga0496115_0000245 3300048918 Bacteria 49174
109 Ga0496121_0001035 3300048924 Bacteria 49640
110 Ga0501032_0023971 3300049569 Bacteria 4215
111 Ga0501037_0011662 3300049573 Bacteria 6471
112 Ga0501040_0151394 3300049576 Bacteria 1636
113 Ga0501048_0005126 3300049582 Bacteria 9981
114 Ga0501069_0020981 3300049585 Bacteria 3543
115 Ga0501073_0090753 3300049589 Bacteria 2123
116 Ga0501074_0029538 3300049590 Bacteria 3971
117 Ga0501080_0067737 3300049742 Bacteria 3320
118 Ga0501080_0251189 3300049742 Bacteria 1612
119 Ga0501083_0005723 3300049744 Bacteria 8796
120 nmdc:mga05p37_86494_c1 3300050507 Bacteria 3863
121 nmdc:mga0n895_13837_c1 3300050512 Bacteria 7301
122 nmdc:mga0rr50_94698_c1 3300050513 Bacteria 2333
123 nmdc:mga08x19_81596_c1 3300050514 Bacteria 2124
124 Ga0495601_0024246 3300053077 Bacteria 3736
125 Ga0501084_0062316 3300054114 Bacteria 3121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0136498 Ga0466958_0136498_79_1206 367
2 3300005577 Ga0068857_100105706 Ga0068857_1001057062 372
3 3300048905 Ga0496102_0000027 Ga0496102_0000027_99784_100947 385
4 3300048906 Ga0496103_0000062 Ga0496103_0000062_88707_89870 385
5 3300045836 Ga0466958_0011514 Ga0466958_0011514_1081_2322 408
6 3300006871 Ga0075434_100007958 Ga0075434_1000079583 409
7 3300006914 Ga0075436_100063678 Ga0075436_1000636782 409
8 3300007076 Ga0075435_100096127 Ga0075435_1000961272 409
9 3300050507 nmdc:mga05p37_86494_c1 nmdc:mga05p37_86494_c1_1751_3049 409
10 3300050512 nmdc:mga0n895_13837_c1 nmdc:mga0n895_13837_c1_5825_7123 409
11 3300050513 nmdc:mga0rr50_94698_c1 nmdc:mga0rr50_94698_c1_910_2208 409
12 3300050514 nmdc:mga08x19_81596_c1 nmdc:mga08x19_81596_c1_173_1471 409
13 3300005981 Ga0081538_10002183 Ga0081538_1000218312 410
14 3300049573 Ga0501037_0011662 Ga0501037_0011662_388_1668 411
15 3300049576 Ga0501040_0151394 Ga0501040_0151394_164_1444 411
16 3300049589 Ga0501073_0090753 Ga0501073_0090753_773_2053 411
17 3300049742 Ga0501080_0251189 Ga0501080_0251189_321_1601 411
18 3300049744 Ga0501083_0005723 Ga0501083_0005723_5646_6926 411
19 3300054114 Ga0501084_0062316 Ga0501084_0062316_1362_2642 411
20 3300046473 Ga0495582_0125387 Ga0495582_0125387_187_1431 412
21 3300046517 Ga0495630_0079226 Ga0495630_0079226_159_1463 414
22 3300005439 Ga0070711_100000367 Ga0070711_10000036714 415
23 3300025916 Ga0207663_10002294 Ga0207663_100022944 415
24 3300037418 Ga0395900_0039639 Ga0395900_0039639_2774_4075 416
25 3300046477 Ga0495664_0000012 Ga0495664_0000012_89016_90278 418
26 3300006051 Ga0075364_10049672 Ga0075364_100496721 426
27 3300049582 Ga0501048_0005126 Ga0501048_0005126_8627_9913 427
28 3300005981 Ga0081538_10000939 Ga0081538_1000093920 428
29 3300048915 Ga0496112_0000139 Ga0496112_0000139_41112_42449 430
30 3300005441 Ga0070700_100036746 Ga0070700_1000367461 431
31 3300005437 Ga0070710_10024710 Ga0070710_100247103 432
32 3300005546 Ga0070696_100037620 Ga0070696_1000376203 432
33 3300006871 Ga0075434_100062641 Ga0075434_1000626412 432
34 3300048903 Ga0496100_0060529 Ga0496100_0060529_663_1997 432
35 3300048904 Ga0496101_0025054 Ga0496101_0025054_171_1505 432
36 3300048905 Ga0496102_0217424 Ga0496102_0217424_196_1530 432
37 3300048909 Ga0496106_0207396 Ga0496106_0207396_68_1402 432
38 3300048910 Ga0496107_0139972 Ga0496107_0139972_405_1739 432
39 3300048917 Ga0496114_0101481 Ga0496114_0101481_376_1710 432
40 3300005937 Ga0081455_10024445 Ga0081455_100244453 440
41 3300028800 Ga0265338_10044773 Ga0265338_100447732 441
42 3300005339 Ga0070660_100062194 Ga0070660_1000621943 442
43 3300005983 Ga0081540_1000366 Ga0081540_100036633 442
44 3300005983 Ga0081540_1000828 Ga0081540_100082811 442
45 3300025919 Ga0207657_10077852 Ga0207657_100778522 442
46 3300048904 Ga0496101_0047253 Ga0496101_0047253_1340_2674 442
47 3300048905 Ga0496102_0007810 Ga0496102_0007810_6656_7990 442
48 3300048907 Ga0496104_0008394 Ga0496104_0008394_7208_8542 442
49 3300048909 Ga0496106_0011315 Ga0496106_0011315_447_1781 442
50 3300048911 Ga0496108_0001875 Ga0496108_0001875_489_1823 442
51 3300048911 Ga0496108_0055299 Ga0496108_0055299_637_1971 442
52 3300048912 Ga0496109_0001110 Ga0496109_0001110_4211_5545 442
53 3300048913 Ga0496110_0021970 Ga0496110_0021970_878_2212 442
54 3300048914 Ga0496111_0027127 Ga0496111_0027127_485_1819 442
55 3300048915 Ga0496112_0021036 Ga0496112_0021036_4212_5546 442
56 3300048916 Ga0496113_0004250 Ga0496113_0004250_6961_8295 442
57 3300048916 Ga0496113_0058515 Ga0496113_0058515_205_1539 442
58 3300048917 Ga0496114_0213015 Ga0496114_0213015_64_1398 442
59 3300049585 Ga0501069_0020981 Ga0501069_0020981_1111_2445 442
60 3300049590 Ga0501074_0029538 Ga0501074_0029538_2601_3935 442
61 3300049742 Ga0501080_0067737 Ga0501080_0067737_77_1411 442
62 3300009098 Ga0105245_10141405 Ga0105245_101414052 443
63 3300048924 Ga0496121_0001035 Ga0496121_0001035_42025_43377 443
64 3300049569 Ga0501032_0023971 Ga0501032_0023971_1321_2709 443
65 3300005468 Ga0070707_100237281 Ga0070707_1002372812 444
66 3300005985 Ga0081539_10004991 Ga0081539_1000499111 444
67 3300025922 Ga0207646_10219268 Ga0207646_102192682 444
68 3300047317 Ga0495604_0000180 Ga0495604_0000180_36644_37984 444
69 3300048907 Ga0496104_0000026 Ga0496104_0000026_68126_69466 444
70 3300048913 Ga0496110_0000183 Ga0496110_0000183_24608_25948 444
71 3300048914 Ga0496111_0000006 Ga0496111_0000006_38178_39518 444
72 3300005436 Ga0070713_100075918 Ga0070713_1000759183 445
73 3300005548 Ga0070665_100001256 Ga0070665_10000125626 445
74 3300013307 Ga0157372_10126328 Ga0157372_101263283 445
75 3300025916 Ga0207663_10174112 Ga0207663_101741121 445
76 3300025939 Ga0207665_10020036 Ga0207665_100200364 445
77 3300025945 Ga0207679_10100264 Ga0207679_101002642 445
78 3300028379 Ga0268266_10004886 Ga0268266_1000488614 445
79 3300046543 Ga0495645_0001598 Ga0495645_0001598_2041_3384 445
80 3300047471 Ga0495684_0010634 Ga0495684_0010634_595_1938 445
81 3300048903 Ga0496100_0011250 Ga0496100_0011250_2256_3599 445
82 3300048915 Ga0496112_0213209 Ga0496112_0213209_61_1404 445
83 3300048918 Ga0496115_0000222 Ga0496115_0000222_34813_36156 445
84 3300048918 Ga0496115_0000245 Ga0496115_0000245_30047_31390 445
85 3300053077 Ga0495601_0024246 Ga0495601_0024246_539_1882 445
86 3300028577 Ga0265318_10014657 Ga0265318_100146574 446
87 3300028666 Ga0265336_10000005 Ga0265336_10000005162 446
88 3300028800 Ga0265338_10000001 Ga0265338_10000001978 446
89 3300029957 Ga0265324_10006677 Ga0265324_100066774 446
90 3300031247 Ga0265340_10000001 Ga0265340_10000001976 446
91 3300031251 Ga0265327_10010027 Ga0265327_100100275 446
92 3300031251 Ga0265327_10013347 Ga0265327_100133474 446
93 3300031344 Ga0265316_10012453 Ga0265316_100124538 446
94 3300031344 Ga0265316_10105527 Ga0265316_101055272 446
95 3300048912 Ga0496109_0018888 Ga0496109_0018888_3639_5015 446
96 3300048914 Ga0496111_0069971 Ga0496111_0069971_598_1968 446
97 3300044694 Ga0466963_0000353 Ga0466963_0000353_1368_2729 447
98 3300005985 Ga0081539_10012416 Ga0081539_100124165 449
99 3300005981 Ga0081538_10068065 Ga0081538_100680651 452
100 3300037418 Ga0395900_0129137 Ga0395900_0129137_95_1471 452
101 3300044684 Ga0466966_0091788 Ga0466966_0091788_437_1810 452
102 3300014326 Ga0157380_10249485 Ga0157380_102494851 454
103 3300005338 Ga0068868_100005307 Ga0068868_1000053072 459
104 3300005366 Ga0070659_100035640 Ga0070659_1000356402 459
105 3300005535 Ga0070684_100237264 Ga0070684_1002372642 459
106 3300005616 Ga0068852_100164165 Ga0068852_1001641652 459
107 3300005618 Ga0068864_100054605 Ga0068864_1000546052 459
108 3300005844 Ga0068862_100049104 Ga0068862_1000491041 459
109 3300006881 Ga0068865_100069586 Ga0068865_1000695862 459
110 3300009098 Ga0105245_10227031 Ga0105245_102270312 459
111 3300009553 Ga0105249_10059197 Ga0105249_100591974 459
112 3300013308 Ga0157375_10279213 Ga0157375_102792132 459
113 3300025899 Ga0207642_10053842 Ga0207642_100538422 459
114 3300025927 Ga0207687_10101958 Ga0207687_101019582 459
115 3300025935 Ga0207709_10003922 Ga0207709_100039228 459
116 3300025938 Ga0207704_10015638 Ga0207704_100156382 459
117 3300025938 Ga0207704_10027564 Ga0207704_100275643 459
118 3300025942 Ga0207689_10069883 Ga0207689_100698832 459
119 3300025972 Ga0207668_10195096 Ga0207668_101950962 459
120 3300045976 Ga0466967_0177625 Ga0466967_0177625_467_1849 459
121 3300048905 Ga0496102_0086421 Ga0496102_0086421_990_2369 459
122 3300048907 Ga0496104_0125431 Ga0496104_0125431_172_1551 459
123 3300048909 Ga0496106_0160529 Ga0496106_0160529_264_1643 459
124 3300048911 Ga0496108_0035469 Ga0496108_0035469_526_1905 459
125 3300048914 Ga0496111_0062068 Ga0496111_0062068_319_1698 459

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12890

DHOase

Dihydro-orotase-like

72

261

0.86

PF01979

Amidohydro_1

Amidohydrolase family

74

440

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yiw-assembly1.cif.gz_A dihydroorotase from bacillus anthracis with substrate bound 0.9443 23 454
4yiw-assembly1.cif.gz_A dihydroorotase from bacillus anthracis with substrate bound 0.9378 23 454
3gri-assembly1.cif.gz_A the crystal structure of a dihydroorotase from staphylococcus aureus 0.9349 23 453
3gri-assembly1.cif.gz_A the crystal structure of a dihydroorotase from staphylococcus aureus 0.9307 23 453
6gde-assembly1.cif.gz_A dihydroorotase from aquifex aeolicus standard (p,t) 0.9252 21 453
ID Description Score Start End Superfamily
3griA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9316 79 395 3.20.20.140
1gkqA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9313 23 78 2.30.40.10
3griA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.923 79 395 3.20.20.140
1gkpB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9182 23 77 2.30.40.10
6gddA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9034 22 77 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A0F8WX49-F1-model_v4 Uncharacterized protein 0.9583 96 459 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A2V2STF7-F1-model_v4 deleted 0.9578 13 408
AF-A0A496P969-F1-model_v4 Dihydroorotase 0.9525 22 174 GO:0004038
GO:0005737
GO:0006145
AF-A0A4R1BJC6-F1-model_v4 Dihydroorotase (DHOase) (EC 3.5.2.3) 0.9517 20 454 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0008270
GO:0044205
AF-A0A7V3CDV0-F1-model_v4 Dihydroorotase (DHOase) (EC 3.5.2.3) 0.9506 18 453 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0008270
GO:0044205

Feature Viewer

pLDDT pTM Quality
85.47 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map