F126226

General Info

Members Datasets Scaffolds Average Seq Length
125 88 250 351

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10034323|Ga0105240_100343233
Length 392
Sequence MFLRGLSRAERIFFEGNYGVGGVGRGYNFSVVVFSGPLLGDVMSLKSLIATGTKVWLDSIDPELVKKNRALGATGATSNPIIISDLIKSGHFDADLTAFMEKGMGDDEIAWALTDKLVKSAQEVFLPVWEQTRGNDGYVSFELDPLLEDKAKPVEHGEAVRRYIELAKKWSAGHKNRMIKIPATAAGLDAMEEVARMEVTINVTLIFSQRQYEIARTNIWRGAQERAGGMKGFKSVYSIFVSRVDVYTEKKVRELSPAAQGMVGIVNAKRMWRSNQAFWAGKNLPLAQEMIFASTGVKKKGDPADKYVEALAGSDIQTNPPATNEAVEQSDKVYTRQVEIMPAKAVLDEIDQKVDQKKMEETLMEEGTAKFADPQHALLKLIAERRGVLAGK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
66 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
67 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
68 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.4
Metatranscriptomes 5.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 0
Rhizosphere 99.2
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10034323 3300009093 Bacteria 6545
2 Ga0065712_10068822 3300005290 Bacteria 8901
3 Ga0065707_10159608 3300005295 Bacteria 1575
4 Ga0070683_100227477 3300005329 Bacteria 1773
5 Ga0070670_100018320 3300005331 Bacteria 6008
6 Ga0070675_100125800 3300005354 Bacteria 2180
7 Ga0070671_100226587 3300005355 Bacteria 1586
8 Ga0070674_100153217 3300005356 Bacteria 1741
9 Ga0070714_100010891 3300005435 Bacteria 7200
10 Ga0070714_100087009 3300005435 Bacteria 2732
11 Ga0070679_100315394 3300005530 Unclassified 1513
12 Ga0068853_100058484 3300005539 Bacteria 3328
13 Ga0070672_100233746 3300005543 Bacteria 1545
14 Ga0070665_100000740 3300005548 Bacteria 43471
15 Ga0070665_100063697 3300005548 Unclassified 3697
16 Ga0068855_100302772 3300005563 Bacteria 1770
17 Ga0068855_100533285 3300005563 Bacteria 1272
18 Ga0068857_100050340 3300005577 Bacteria 3696
19 Ga0068860_100530113 3300005843 Bacteria 1178
20 Ga0068862_100428268 3300005844 Bacteria 1243
21 Ga0081539_10006933 3300005985 Bacteria 10540
22 Ga0097621_100261642 3300006237 Bacteria 1518
23 Ga0075431_100164299 3300006847 Bacteria 2282
24 Ga0105240_10078987 3300009093 Unclassified 4051
25 Ga0105241_10053821 3300009174 Bacteria 3079
26 Ga0105237_10508533 3300009545 Bacteria 1211
27 Ga0105249_10039974 3300009553 Bacteria 4259
28 Ga0105249_10147632 3300009553 Bacteria 2261
29 Ga0105239_10132203 3300010375 Bacteria 2777
30 Ga0105239_10461918 3300010375 Bacteria 1441
31 Ga0105239_10528047 3300010375 Bacteria 1343
32 Ga0157371_10057859 3300013102 Bacteria 2750
33 Ga0157370_10009005 3300013104 Bacteria 10714
34 Ga0157370_10010514 3300013104 Bacteria 9745
35 Ga0157369_10013792 3300013105 Bacteria 9135
36 Ga0163162_10613104 3300013306 Bacteria 1214
37 Ga0157372_10203777 3300013307 Bacteria 2292
38 Ga0157372_10379686 3300013307 Bacteria 1647
39 Ga0157375_10355484 3300013308 Bacteria 1631
40 Ga0197907_10299343 3300020069 Bacteria 1126
41 Ga0206351_10374991 3300020077 Bacteria 1950
42 Ga0206350_10919521 3300020080 Bacteria 1268
43 Ga0224712_10008955 3300022467 Bacteria 2994
44 Ga0224712_10100050 3300022467 Bacteria 1228
45 Ga0207692_10069941 3300025898 Bacteria 1846
46 Ga0207695_10008422 3300025913 Bacteria 12916
47 Ga0207695_10054456 3300025913 Unclassified 4177
48 Ga0207695_10140491 3300025913 Bacteria 2364
49 Ga0207652_10511388 3300025921 Bacteria 1081
50 Ga0207659_10205883 3300025926 Bacteria 1574
51 Ga0207659_10262846 3300025926 Viruses 1405
52 Ga0207659_10323759 3300025926 Bacteria 1272
53 Ga0207700_10190660 3300025928 Bacteria 1722
54 Ga0207664_10008586 3300025929 Bacteria 7138
55 Ga0207664_10083566 3300025929 Bacteria 2603
56 Ga0207644_10193116 3300025931 Bacteria 1602
57 Ga0207691_10012576 3300025940 Bacteria 8112
58 Ga0207667_10072468 3300025949 Bacteria 3580
59 Ga0207667_10114752 3300025949 Bacteria 2776
60 Ga0207667_10341825 3300025949 Bacteria 1527
61 Ga0207667_10408137 3300025949 Bacteria 1383
62 Ga0207651_10213568 3300025960 Bacteria 1555
63 Ga0207639_10042046 3300026041 Unclassified 3424
64 Ga0207639_10267644 3300026041 Bacteria 1498
65 Ga0207674_10000440 3300026116 Bacteria 53812
66 Ga0268266_10001040 3300028379 Bacteria 34844
67 Ga0268266_10317631 3300028379 Bacteria 1457
68 Ga0265338_10012074 3300028800 Bacteria 9878
69 Ga0265338_10056061 3300028800 Unclassified 3500
70 Ga0265760_10003045 3300031090 Bacteria 4895
71 Ga0265760_10050737 3300031090 Unclassified 1249
72 Ga0265332_10036250 3300031238 Bacteria 2141
73 Ga0265325_10005375 3300031241 Bacteria 7917
74 Ga0265339_10000274 3300031249 Bacteria 41704
75 Ga0265331_10000120 3300031250 Bacteria 102675
76 Ga0265313_10001042 3300031595 Bacteria 26993
77 Ga0265314_10000096 3300031711 Bacteria 134365
78 Ga0265342_10008951 3300031712 Bacteria 7111
79 Ga0373955_0151171 3300035172 Bacteria 1367
80 Ga0453684_0348817 3300044712 Unclassified 1670
81 Ga0495582_0093666 3300046473 Bacteria 1677
82 Ga0495608_0004606 3300046511 Bacteria 9844
83 Ga0495630_0002887 3300046517 Bacteria 11948
84 Ga0495652_0215337 3300046529 Bacteria 1447
85 Ga0495667_0003088 3300046559 Bacteria 11170
86 Ga0495613_0040909 3300046689 Bacteria 3433
87 Ga0495624_0008245 3300046690 Bacteria 7285
88 Ga0495604_0046576 3300047317 Bacteria 3381
89 Ga0495674_0028571 3300047319 Bacteria 5082
90 Ga0495684_0027309 3300047471 Bacteria 4383
91 Ga0501032_0047894 3300049569 Bacteria 2886
92 Ga0501033_0035768 3300049570 Unclassified 3723
93 Ga0501033_0049264 3300049570 Bacteria 3127
94 Ga0501034_0000107 3300049571 Bacteria 152521
95 Ga0501034_0001876 3300049571 Bacteria 26659
96 Ga0501034_0002585 3300049571 Bacteria 21525
97 Ga0501034_0024306 3300049571 Bacteria 6163
98 Ga0501034_0026695 3300049571 Bacteria 5876
99 Ga0501034_0130289 3300049571 Bacteria 2499
100 Ga0501037_0008146 3300049573 Bacteria 7680
101 Ga0501038_0002605 3300049574 Bacteria 16861
102 Ga0501043_0000551 3300049579 Bacteria 33573
103 Ga0501043_0057698 3300049579 Bacteria 3048
104 Ga0501043_0063759 3300049579 Unclassified 2894
105 Ga0501046_0000001 3300049580 Bacteria 609806
106 Ga0501046_0006952 3300049580 Bacteria 9972
107 Ga0501046_0017121 3300049580 Bacteria 6056
108 Ga0501047_0011789 3300049581 Bacteria 8265
109 Ga0501047_0024829 3300049581 Bacteria 5754
110 Ga0501047_0080668 3300049581 Bacteria 3127
111 Ga0501048_0000851 3300049582 Bacteria 22476
112 Ga0501070_0003637 3300049586 Bacteria 13328
113 Ga0501073_0042419 3300049589 Bacteria 3211
114 Ga0501080_0006848 3300049742 Bacteria 10280
115 Ga0501083_0000001 3300049744 Bacteria 555041
116 Ga0501083_0213996 3300049744 Bacteria 1256
117 Ga0501035_0029809 3300049822 Bacteria 4976
118 Ga0501044_0000798 3300049823 Bacteria 37934
119 Ga0501044_0011198 3300049823 Bacteria 9727
120 nmdc:mga0yw44_194220_c1 3300050492 Bacteria 1339
121 nmdc:mga08y16_298030_c1 3300050511 Bacteria 1662
122 Ga0495601_0012625 3300053077 Bacteria 5066
123 Ga0495601_0032752 3300053077 Unclassified 3237
124 Ga0495619_0010158 3300053085 Bacteria 5929
125 Ga0501084_0033398 3300054114 Bacteria 4305
126 Ga0105240_10034323
127 Ga0065712_10068822
128 Ga0065707_10159608
129 Ga0070683_100227477
130 Ga0070670_100018320
131 Ga0070675_100125800
132 Ga0070671_100226587
133 Ga0070674_100153217
134 Ga0070714_100010891
135 Ga0070714_100087009
136 Ga0070679_100315394
137 Ga0068853_100058484
138 Ga0070672_100233746
139 Ga0070665_100000740
140 Ga0070665_100063697
141 Ga0068855_100302772
142 Ga0068855_100533285
143 Ga0068857_100050340
144 Ga0068860_100530113
145 Ga0068862_100428268
146 Ga0081539_10006933
147 Ga0097621_100261642
148 Ga0075431_100164299
149 Ga0105240_10078987
150 Ga0105241_10053821
151 Ga0105237_10508533
152 Ga0105249_10039974
153 Ga0105249_10147632
154 Ga0105239_10132203
155 Ga0105239_10461918
156 Ga0105239_10528047
157 Ga0157371_10057859
158 Ga0157370_10009005
159 Ga0157370_10010514
160 Ga0157369_10013792
161 Ga0163162_10613104
162 Ga0157372_10203777
163 Ga0157372_10379686
164 Ga0157375_10355484
165 Ga0197907_10299343
166 Ga0206351_10374991
167 Ga0206350_10919521
168 Ga0224712_10008955
169 Ga0224712_10100050
170 Ga0207692_10069941
171 Ga0207695_10008422
172 Ga0207695_10054456
173 Ga0207695_10140491
174 Ga0207652_10511388
175 Ga0207659_10205883
176 Ga0207659_10262846
177 Ga0207659_10323759
178 Ga0207700_10190660
179 Ga0207664_10008586
180 Ga0207664_10083566
181 Ga0207644_10193116
182 Ga0207691_10012576
183 Ga0207667_10072468
184 Ga0207667_10114752
185 Ga0207667_10341825
186 Ga0207667_10408137
187 Ga0207651_10213568
188 Ga0207639_10042046
189 Ga0207639_10267644
190 Ga0207674_10000440
191 Ga0268266_10001040
192 Ga0268266_10317631
193 Ga0265338_10012074
194 Ga0265338_10056061
195 Ga0265760_10003045
196 Ga0265760_10050737
197 Ga0265332_10036250
198 Ga0265325_10005375
199 Ga0265339_10000274
200 Ga0265331_10000120
201 Ga0265313_10001042
202 Ga0265314_10000096
203 Ga0265342_10008951
204 Ga0373955_0151171
205 Ga0453684_0348817
206 Ga0495582_0093666
207 Ga0495608_0004606
208 Ga0495630_0002887
209 Ga0495652_0215337
210 Ga0495667_0003088
211 Ga0495613_0040909
212 Ga0495624_0008245
213 Ga0495604_0046576
214 Ga0495674_0028571
215 Ga0495684_0027309
216 Ga0501032_0047894
217 Ga0501033_0035768
218 Ga0501033_0049264
219 Ga0501034_0000107
220 Ga0501034_0001876
221 Ga0501034_0002585
222 Ga0501034_0024306
223 Ga0501034_0026695
224 Ga0501034_0130289
225 Ga0501037_0008146
226 Ga0501038_0002605
227 Ga0501043_0000551
228 Ga0501043_0057698
229 Ga0501043_0063759
230 Ga0501046_0000001
231 Ga0501046_0006952
232 Ga0501046_0017121
233 Ga0501047_0011789
234 Ga0501047_0024829
235 Ga0501047_0080668
236 Ga0501048_0000851
237 Ga0501070_0003637
238 Ga0501073_0042419
239 Ga0501080_0006848
240 Ga0501083_0000001
241 Ga0501083_0213996
242 Ga0501035_0029809
243 Ga0501044_0000798
244 Ga0501044_0011198
245 nmdc:mga0yw44_194220_c1
246 nmdc:mga08y16_298030_c1
247 Ga0495601_0012625
248 Ga0495601_0032752
249 Ga0495619_0010158
250 Ga0501084_0033398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

55

382

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7odq-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase at 5.4 mgy dose 0.8729 15 354
7oey-assembly1.cif.gz_B neisseria gonnorhoeae variant e93q at 1.35 angstrom resolution 0.8727 16 354
7bbx-assembly1.cif.gz_A neisseria gonorrhoeae transaldolase, variant k8a 0.871 15 354
3r5e-assembly1.cif.gz_A transaldolase from corynebacterium glutamicum 0.8708 15 357
7bbw-assembly2.cif.gz_B neisseria gonorrhoeae transaldolase, variant c38s 0.8603 18 354
ID Description Score Start End Superfamily
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8977 51 251 3.20.20.70
af_B4FRC9_66_421_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8885 18 357 3.20.20.70
3r5eA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8708 15 357 3.20.20.70
af_K7L4A2_15_219_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8642 51 251 3.20.20.70
3clmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8559 17 354 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7C1JNZ2-F1-model_v4 transaldolase (EC 2.2.1.2) 0.9915 17 299 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A7G9NTL3-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9879 15 362 GO:0004801
GO:0005737
GO:0005975
GO:0006098
AF-A0A1Z9QML0-F1-model_v4 Uncharacterized protein 0.9879 133 197 GO:0005975
AF-A0A1Z9QMS5-F1-model_v4 Uncharacterized protein 0.9788 212 314 GO:0005975
AF-A0A3D2THC0-F1-model_v4 Transaldolase 0.9775 81 363 GO:0005975

Map