F124806

General Info

Members Datasets Scaffolds Average Seq Length
125 109 250 251

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1005775|JGI25160J50197_10057755
Length 280
Sequence MRAAQLGSDWYVTRKVYEMGILNGKTAVVTGSTSGIGLACAQAFAKAGANVVMNGMGAPADIENERAAIERAFAVRAIYSPADMTKPSEVAELVALGEATFGSVDILVNNAGIQHVSPIEDFPAEKWDAVIAINLSAAFHAIRAAVPGMKKRGWGRIITTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELARSKITCNCISPGYVWTPLVEKQIPNTMAARRMRRDEVISDVLLAAQPTKEFVTVEQVASLALFLCSDDAAQITGANLSMDGGWTAA

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
33 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
35 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
36 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
49 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
52 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
53 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
54 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
55 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
56 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
59 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
60 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
61 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
62 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
63 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
64 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
77 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
78 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
79 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
80 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
81 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
84 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
85 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
86 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
87 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
88 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
89 2643221733 Bosea sp. Root381 Isolate Unclassified
90 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
91 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
92 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
93 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
94 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
95 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
96 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
97 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
98 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
99 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
100 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
101 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
102 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
103 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
104 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
105 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
106 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
107 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
108 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
109 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.8
Metatranscriptomes 0
Isolates 23.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 12
Rhizoplane 9.6
Rhizosphere 49.6
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1005775 3300003354 Bacteria 5102
2 JGI25404J52841_10038471 3300003659 Bacteria 1015
3 Ga0065165_1000147 3300005262 Bacteria 122698
4 Ga0070674_100202125 3300005356 Bacteria 1535
5 Ga0070674_100444316 3300005356 Bacteria 1069
6 Ga0070713_100084567 3300005436 Bacteria 2715
7 Ga0070678_100397284 3300005456 Bacteria 1197
8 Ga0070679_100193812 3300005530 Bacteria 2000
9 Ga0070665_100391989 3300005548 Bacteria 1396
10 Ga0070665_100466209 3300005548 Bacteria 1273
11 Ga0068858_100000045 3300005842 Bacteria 127595
12 Ga0081539_10014369 3300005985 Bacteria 5862
13 Ga0075365_10096813 3300006038 Bacteria 2017
14 Ga0075365_10129268 3300006038 Bacteria 1747
15 Ga0075363_100035864 3300006048 Bacteria 2598
16 Ga0075364_10316840 3300006051 Bacteria 1062
17 Ga0075367_10011888 3300006178 Bacteria 4623
18 Ga0075369_10001639 3300006186 Bacteria 7716
19 Ga0075430_100066576 3300006846 Bacteria 3025
20 Ga0075430_100218053 3300006846 Bacteria 1583
21 Ga0075431_100180114 3300006847 Bacteria 2169
22 Ga0105248_10002973 3300009177 Bacteria 18777
23 Ga0157314_1005511 3300012500 Bacteria 962
24 Ga0163162_10519304 3300013306 Bacteria 1320
25 Ga0163162_11340770 3300013306 Bacteria 813
26 Ga0157379_10000058 3300014968 Bacteria 69871
27 Ga0157376_10340335 3300014969 Bacteria 1432
28 Ga0209758_1002614 3300025297 Bacteria 17928
29 Ga0207426_1000212 3300025302 Bacteria 137314
30 Ga0207645_10140866 3300025907 Bacteria 1571
31 Ga0207652_10091767 3300025921 Bacteria 2671
32 Ga0207700_10368971 3300025928 Bacteria 1253
33 Ga0207686_10479542 3300025934 Bacteria 961
34 Ga0207709_10182877 3300025935 Bacteria 1482
35 Ga0207711_10000759 3300025941 Bacteria 31652
36 Ga0207703_10000009 3300026035 Bacteria 343983
37 Ga0209813_10011741 3300027866 Bacteria 2298
38 Ga0268266_10136145 3300028379 Bacteria 2200
39 Ga0268266_10470091 3300028379 Bacteria 1197
40 Ga0307517_10000497 3300028786 Bacteria 67390
41 Ga0265328_10000601 3300031239 Bacteria 16722
42 Ga0265331_10029180 3300031250 Bacteria 2755
43 Ga0265327_10016967 3300031251 Bacteria 4592
44 Ga0307513_10028374 3300031456 Bacteria 6401
45 Ga0307408_100238171 3300031548 Bacteria 1494
46 Ga0307410_10025040 3300031852 Bacteria 3737
47 Ga0307409_100170351 3300031995 Bacteria 1916
48 Ga0307416_100219881 3300032002 Bacteria 1820
49 Ga0307415_100323262 3300032126 Bacteria 1287
50 Ga0307510_10043023 3300033180 Bacteria 4914
51 Ga0373925_0098666 3300037068 Bacteria 2242
52 Ga0395905_0068761 3300037471 Bacteria 3317
53 Ga0395905_0220494 3300037471 Bacteria 1775
54 Ga0395905_0491602 3300037471 Bacteria 1127
55 Ga0436364_1278760 3300037853 Bacteria 1032
56 Ga0436365_0625332 3300039437 Bacteria 1062
57 Ga0451853_1326743 3300041512 Bacteria 751
58 Ga0439458_0000178 3300042157 Bacteria 14355
59 Ga0466960_0015541 3300044901 Bacteria 3283
60 Ga0495641_0218093 3300046461 Bacteria 856
61 Ga0495648_0102459 3300046524 Bacteria 1577
62 Ga0495683_0129691 3300047323 Bacteria 1190
63 Ga0496100_0101590 3300048903 Bacteria 1983
64 Ga0496104_0233402 3300048907 Bacteria 1751
65 Ga0496106_0014678 3300048909 Bacteria 5790
66 Ga0496108_0372200 3300048911 Bacteria 1247
67 Ga0496110_0135019 3300048913 Bacteria 2229
68 Ga0496110_0514627 3300048913 Bacteria 1089
69 Ga0496110_0766582 3300048913 Bacteria 868
70 Ga0496111_0011918 3300048914 Bacteria 5875
71 Ga0496111_0358059 3300048914 Bacteria 1080
72 Ga0496112_0132791 3300048915 Bacteria 2460
73 Ga0496113_0070472 3300048916 Bacteria 2657
74 Ga0496115_0591023 3300048918 Unclassified 883
75 Ga0496119_0000483 3300048922 Bacteria 54518
76 Ga0501031_0053968 3300049568 Bacteria 2619
77 Ga0501034_0628540 3300049571 Bacteria 977
78 Ga0501038_0327186 3300049574 Bacteria 1198
79 Ga0501040_0178922 3300049576 Bacteria 1503
80 Ga0501042_0127098 3300049578 Bacteria 1836
81 Ga0501048_0037457 3300049582 Bacteria 3483
82 Ga0501071_0043397 3300049587 Bacteria 3224
83 Ga0501072_0064886 3300049588 Bacteria 2879
84 Ga0501075_0200339 3300049591 Bacteria 1523
85 Ga0501035_0360596 3300049822 Bacteria 1215
86 Ga0501035_0404631 3300049822 Bacteria 1135
87 Ga0501044_0001920 3300049823 Bacteria 24059
88 nmdc:mga00v17_42658_c1 3300050491 Bacteria 2729
89 nmdc:mga0yw44_207154_c1 3300050492 Bacteria 1297
90 nmdc:mga0qj67_161457_c1 3300050509 Bacteria 1819
91 nmdc:mga0qj67_94035_c1 3300050509 Bacteria 2411
92 nmdc:mga0n895_312946_c1 3300050512 Bacteria 1591
93 nmdc:mga0sz30_71717_c2 3300050516 Bacteria 1149
94 Ga0500650_0163779 3300053098 Bacteria 1025
95 Ga0501084_0184873 3300054114 Bacteria 1759
96 Ga0530510_0157128 3300061734 Bacteria 1681
97 2513644555 2513237094 Bacteria 8789602
98 2513716265 2513237104 Bacteria 10034502
99 2517104662 2517093001 Bacteria 9002274
100 2524441230 2524023205 Bacteria 8918781
101 2596377287 2595698237 Bacteria 6712432
102 2644728596 2643221733 Bacteria 5690728
103 2738745883 2738541281 Bacteria 5112672
104 2739355113 2738543032 Bacteria 5115625
105 2805921422 2802429603 Bacteria 8777136
106 2824700026 2824696289 Bacteria 8335049
107 2835315996 2835312727 Bacteria 7413381
108 2835317465 2835312727 Bacteria 7413381
109 2835319620 2835312727 Bacteria 7413381
110 2835320144 2835312727 Bacteria 7413381
111 2847932389 2847930680 Bacteria 9342022
112 2847944393 2847939898 Bacteria 8606328
113 2857515293 2857509624 Bacteria 7472071
114 2874634022 2874628541 Bacteria 8630250
115 2885367836 2885366525 Bacteria 8326213
116 2885383052 2885374607 Bacteria 8927485
117 2894235828 2894232714 Bacteria 8834183
118 2903752787 2903748898 Bacteria 9972761
119 2906637307 2906635258 Bacteria 8601019
120 2935624068 2935616580 Bacteria 9032984
121 2935862432 2935855204 Bacteria 9035059
122 2935870567 2935864058 Bacteria 9784707
123 2935881149 2935873716 Bacteria 9632195
124 3005486022 3005483717 Bacteria 7877331
125 3005714680 3005710791 Bacteria 7622528
126 JGI25160J50197_1005775
127 JGI25404J52841_10038471
128 Ga0065165_1000147
129 Ga0070674_100202125
130 Ga0070674_100444316
131 Ga0070713_100084567
132 Ga0070678_100397284
133 Ga0070679_100193812
134 Ga0070665_100391989
135 Ga0070665_100466209
136 Ga0068858_100000045
137 Ga0081539_10014369
138 Ga0075365_10096813
139 Ga0075365_10129268
140 Ga0075363_100035864
141 Ga0075364_10316840
142 Ga0075367_10011888
143 Ga0075369_10001639
144 Ga0075430_100066576
145 Ga0075430_100218053
146 Ga0075431_100180114
147 Ga0105248_10002973
148 Ga0157314_1005511
149 Ga0163162_10519304
150 Ga0163162_11340770
151 Ga0157379_10000058
152 Ga0157376_10340335
153 Ga0209758_1002614
154 Ga0207426_1000212
155 Ga0207645_10140866
156 Ga0207652_10091767
157 Ga0207700_10368971
158 Ga0207686_10479542
159 Ga0207709_10182877
160 Ga0207711_10000759
161 Ga0207703_10000009
162 Ga0209813_10011741
163 Ga0268266_10136145
164 Ga0268266_10470091
165 Ga0307517_10000497
166 Ga0265328_10000601
167 Ga0265331_10029180
168 Ga0265327_10016967
169 Ga0307513_10028374
170 Ga0307408_100238171
171 Ga0307410_10025040
172 Ga0307409_100170351
173 Ga0307416_100219881
174 Ga0307415_100323262
175 Ga0307510_10043023
176 Ga0373925_0098666
177 Ga0395905_0068761
178 Ga0395905_0220494
179 Ga0395905_0491602
180 Ga0436364_1278760
181 Ga0436365_0625332
182 Ga0451853_1326743
183 Ga0439458_0000178
184 Ga0466960_0015541
185 Ga0495641_0218093
186 Ga0495648_0102459
187 Ga0495683_0129691
188 Ga0496100_0101590
189 Ga0496104_0233402
190 Ga0496106_0014678
191 Ga0496108_0372200
192 Ga0496110_0135019
193 Ga0496110_0514627
194 Ga0496110_0766582
195 Ga0496111_0011918
196 Ga0496111_0358059
197 Ga0496112_0132791
198 Ga0496113_0070472
199 Ga0496115_0591023
200 Ga0496119_0000483
201 Ga0501031_0053968
202 Ga0501034_0628540
203 Ga0501038_0327186
204 Ga0501040_0178922
205 Ga0501042_0127098
206 Ga0501048_0037457
207 Ga0501071_0043397
208 Ga0501072_0064886
209 Ga0501075_0200339
210 Ga0501035_0360596
211 Ga0501035_0404631
212 Ga0501044_0001920
213 nmdc:mga00v17_42658_c1
214 nmdc:mga0yw44_207154_c1
215 nmdc:mga0qj67_161457_c1
216 nmdc:mga0qj67_94035_c1
217 nmdc:mga0n895_312946_c1
218 nmdc:mga0sz30_71717_c2
219 Ga0500650_0163779
220 Ga0501084_0184873
221 Ga0530510_0157128
222 2513644555
223 2513716265
224 2517104662
225 2524441230
226 2596377287
227 2644728596
228 2738745883
229 2739355113
230 2805921422
231 2824700026
232 2835315996
233 2835317465
234 2835319620
235 2835320144
236 2847932389
237 2847944393
238 2857515293
239 2874634022
240 2885367836
241 2885383052
242 2894235828
243 2903752787
244 2906637307
245 2935624068
246 2935862432
247 2935870567
248 2935881149
249 3005486022
250 3005714680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

220

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

31

278

0.91

PF08659

KR

KR domain

25

195

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ztu-assembly1.cif.gz_D t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9874 22 280
3v2h-assembly1.cif.gz_B the crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti 0.985 22 280
2ztu-assembly1.cif.gz_C t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9832 22 280
3v2h-assembly1.cif.gz_A the crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti 0.9812 22 280
1x1t-assembly1.cif.gz_A crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with nad+ 0.9808 22 280
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 111 206 3.40.50.720
2q2qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9667 22 280 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 80 199 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 29 280 3.40.50.720
2q2qC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 22 280 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7J7QKH8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.979 19 280 GO:0003858
AF-A0A1A8VD90-F1-model_v4 Retinol dehydrogenase 8b 0.9779 104 198 GO:0004745
GO:0005829
GO:0016020
GO:0042572
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.9699 22 210 GO:0016616
GO:0030497
AF-A0A1H2MXK0-F1-model_v4 Acetoacetyl-CoA synthetase 0.9692 22 265 GO:0003858
GO:0006629
GO:0030729
AF-A0A7J7QKH8-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9681 19 280 GO:0003858

Map