F123623

General Info

Members Datasets Scaffolds Average Seq Length
124 94 93 305

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0044157|Ga0466960_0044157_753_1727
Length 324
Sequence VIEASAPRQRSRLANVDLRIFTEPQQGASYDQILAVAKATEDGGFDAFFRSDHYLHMGDVSGLPGSTDAWVTLAGLARDTRRIRLGTLVSPATFRLPGVLAIEVAQVDAMSGGRAELGLGAGWFEGEHAAYGIPFPGTKERFDRFEEQLAIVTGLWSTPVGEKFSFQGQHYQLSDSPALPKPVQSPMPLIVGGGGKRRTPQLAARYATEFNIGFVPVEGVAAAYERLGAACEEEGRDPASLTYSVALTTVCGSDDAQVAARARAAGHDVDQLRTNGLAGTPDELVDRLGRYAEVGAERAYLQVWDFDDLEMIELIAARVLPQLR

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2643221575 Microbacterium sp. Root61 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2643221649 Leifsonia sp. Root4 Isolate Unclassified
6 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
7 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
8 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
9 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
10 2808606372 Agromyces sp. 23-23 Isolate Unclassified
11 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
12 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
13 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
14 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
15 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
16 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
17 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
18 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
19 2919069694 Microbacterium sp. 1154 Isolate Unclassified
20 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
21 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
22 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
23 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
24 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
25 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
26 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
27 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
37 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
63 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
64 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
67 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
68 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
69 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
88 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
89 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
90 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
91 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
92 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
93 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
94 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0
Isolates 25

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.06
Rhizosphere 52.42
Stem 0
Stem Tuber 0
Unclassified 38.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10062674 3300003320 Bacteria 6290
2 Ga0065714_10083917 3300005288 Bacteria 2225
3 Ga0070676_10148595 3300005328 Bacteria 1498
4 Ga0068852_100081172 3300005616 Bacteria 2878
5 Ga0081539_10008014 3300005985 Bacteria 9372
6 Ga0081539_10010927 3300005985 Bacteria 7283
7 Ga0105244_10020969 3300009036 Bacteria 3621
8 Ga0105244_10159815 3300009036 Bacteria 1076
9 Ga0105237_10129153 3300009545 Bacteria 2522
10 Ga0157369_10012246 3300013105 Bacteria 9741
11 Ga0171462_1002 3300013250 Bacteria 1052134
12 Ga0207689_10138648 3300025942 Bacteria 2003
13 Ga0207668_10094494 3300025972 Bacteria 2205
14 Ga0207676_10541907 3300026095 Bacteria 1111
15 Ga0207683_10085888 3300026121 Bacteria 2797
16 Ga0207698_10162637 3300026142 Bacteria 1954
17 Ga0307405_10512202 3300031731 Bacteria 964
18 Ga0307413_10250027 3300031824 Bacteria 1315
19 Ga0307410_10389201 3300031852 Bacteria 1124
20 Ga0307406_10020806 3300031901 Bacteria 3871
21 Ga0307412_10390377 3300031911 Bacteria 1130
22 Ga0307412_10443363 3300031911 Bacteria 1068
23 Ga0307416_100173519 3300032002 Bacteria 2011
24 Ga0307416_100236437 3300032002 Bacteria 1766
25 Ga0395901_0151898 3300038443 Bacteria 2433
26 Ga0451791_0286324 3300041451 Bacteria 1670
27 Ga0466972_0093849 3300044658 Bacteria 1422
28 Ga0466965_0033666 3300044683 Bacteria 2505
29 Ga0466970_0099028 3300044765 Bacteria 1587
30 Ga0466957_0151929 3300044842 Bacteria 1498
31 Ga0466957_0178018 3300044842 Bacteria 1388
32 Ga0466960_0000352 3300044901 Bacteria 15716
33 Ga0466960_0044157 3300044901 Bacteria 2124
34 Ga0466958_0040643 3300045836 Bacteria 2795
35 Ga0466958_0171190 3300045836 Bacteria 1375
36 Ga0466958_0184809 3300045836 Bacteria 1323
37 Ga0466967_0068475 3300045976 Bacteria 3170
38 Ga0466967_0258804 3300045976 Bacteria 1665
39 Ga0495638_0091906 3300046460 Bacteria 1827
40 Ga0496103_0027772 3300048906 Bacteria 3431
41 Ga0496108_0095198 3300048911 Bacteria 2535
42 Ga0496108_0451519 3300048911 Bacteria 1123
43 Ga0496109_0070160 3300048912 Bacteria 3215
44 Ga0496110_0376912 3300048913 Bacteria 1293
45 Ga0496112_0309012 3300048915 Bacteria 1526
46 Ga0496114_0025944 3300048917 Bacteria 4794
47 Ga0496114_0066192 3300048917 Bacteria 3029
48 Ga0496114_0087338 3300048917 Bacteria 2644
49 Ga0496116_0036093 3300048919 Bacteria 3464
50 Ga0496117_0000069 3300048920 Bacteria 246025
51 Ga0496117_0018350 3300048920 Bacteria 5797
52 Ga0496118_0087588 3300048921 Bacteria 2159
53 Ga0496119_0000804 3300048922 Bacteria 42026
54 Ga0496119_0001501 3300048922 Bacteria 27887
55 Ga0496119_0002562 3300048922 Bacteria 19769
56 Ga0496119_0017882 3300048922 Bacteria 5309
57 Ga0496119_0127576 3300048922 Bacteria 1390
58 Ga0496120_0000577 3300048923 Bacteria 55880
59 Ga0496120_0001038 3300048923 Bacteria 37120
60 Ga0496120_0002197 3300048923 Bacteria 20625
61 Ga0496120_0137521 3300048923 Bacteria 1244
62 Ga0496122_0000022 3300048925 Bacteria 388704
63 Ga0496122_0012793 3300048925 Bacteria 8303
64 Ga0496122_0226138 3300048925 Bacteria 1068
65 Ga0496123_0000016 3300048926 Bacteria 424330
66 Ga0496123_0023178 3300048926 Bacteria 4758
67 Ga0496123_0054400 3300048926 Bacteria 2635
68 Ga0496124_0001871 3300048927 Bacteria 28960
69 Ga0496124_0024026 3300048927 Bacteria 5549
70 Ga0496124_0059280 3300048927 Bacteria 3216
71 Ga0496125_0003258 3300048928 Bacteria 19992
72 Ga0496125_0007450 3300048928 Bacteria 11642
73 Ga0496125_0114724 3300048928 Bacteria 1940
74 Ga0496126_0003707 3300048929 Bacteria 19056
75 Ga0501031_0089615 3300049568 Bacteria 2006
76 Ga0501034_0010872 3300049571 Bacteria 9454
77 Ga0501037_0008450 3300049573 Bacteria 7550
78 Ga0501038_0006713 3300049574 Bacteria 10636
79 Ga0501039_0009772 3300049575 Bacteria 7309
80 Ga0501039_0163550 3300049575 Bacteria 1750
81 Ga0501042_0023590 3300049578 Bacteria 4307
82 Ga0501043_0032626 3300049579 Bacteria 4094
83 Ga0501046_0006812 3300049580 Bacteria 10086
84 Ga0501048_0051237 3300049582 Bacteria 2939
85 Ga0501070_0000637 3300049586 Bacteria 32300
86 Ga0501070_0053510 3300049586 Bacteria 3348
87 Ga0501083_0000057 3300049744 Bacteria 81628
88 Ga0501035_0075338 3300049822 Bacteria 2984
89 Ga0501044_0052477 3300049823 Bacteria 4201
90 Ga0501045_0042599 3300049824 Bacteria 3304
91 Ga0495601_0027028 3300053077 Bacteria 3546
92 Ga0495612_0001227 3300053078 Bacteria 10560
93 Ga0495619_0121046 3300053085 Bacteria 1794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8045830549 8045833975 258
2 3300031901 Ga0307406_10020806 Ga0307406_100208062 262
3 3300032002 Ga0307416_100236437 Ga0307416_1002364372 262
4 3300048922 Ga0496119_0017882 Ga0496119_0017882_4491_5297 265
5 3300013250 Ga0171462_1002 Ga0171462_1002822 276
6 3300005616 Ga0068852_100081172 Ga0068852_1000811723 294
7 3300013105 Ga0157369_10012246 Ga0157369_100122465 294
8 3300026142 Ga0207698_10162637 Ga0207698_101626372 294
9 3300031731 Ga0307405_10512202 Ga0307405_105122021 296
10 3300044765 Ga0466970_0099028 Ga0466970_0099028_543_1457 296
11 iso_pu_bacteria 2833709550 2833712122 298
12 3300025942 Ga0207689_10138648 Ga0207689_101386482 299
13 3300049744 Ga0501083_0000057 Ga0501083_0000057_79223_80143 299
14 3300041451 Ga0451791_0286324 Ga0451791_0286324_161_1090 300
15 iso_pu_bacteria 2643221575 2643886622 301
16 iso_pu_bacteria 2773857763 2774398319 301
17 3300009545 Ga0105237_10129153 Ga0105237_101291533 302
18 3300048906 Ga0496103_0027772 Ga0496103_0027772_1202_2113 302
19 3300048911 Ga0496108_0451519 Ga0496108_0451519_155_1066 302
20 3300048912 Ga0496109_0070160 Ga0496109_0070160_1829_2740 302
21 3300048915 Ga0496112_0309012 Ga0496112_0309012_377_1288 302
22 3300048917 Ga0496114_0025944 Ga0496114_0025944_802_1713 302
23 3300048923 Ga0496120_0137521 Ga0496120_0137521_142_1053 302
24 iso_pu_bacteria 2643221549 2643768105 302
25 iso_pu_bacteria 2643221597 2643996736 302
26 iso_pu_bacteria 2643221619 2644111499 302
27 iso_pu_bacteria 2757320536 2758227641 302
28 iso_pu_bacteria 2773857758 2774381204 302
29 iso_pu_bacteria 2808606306 2808630049 302
30 iso_pu_bacteria 2808606372 2808901644 302
31 iso_pu_bacteria 2811994872 2812324393 302
32 iso_pu_bacteria 2844852863 2844853149 302
33 iso_pu_bacteria 2867346516 2867350822 302
34 iso_pu_bacteria 2868088558 2868088675 302
35 iso_pu_bacteria 2904509784 2904510921 302
36 iso_pu_bacteria 2908678064 2908680344 302
37 iso_pu_bacteria 2919069694 2919072699 302
38 iso_pu_bacteria 2919443155 2919446590 302
39 iso_pu_bacteria 2939660829 2939661803 302
40 iso_pu_bacteria 2974294766 2974296237 302
41 iso_pu_bacteria 2974324384 2974327528 302
42 iso_pu_bacteria 2977228692 2977229150 302
43 iso_pu_bacteria 2977236895 2977238815 302
44 iso_pu_bacteria 2977264416 2977267910 302
45 iso_pu_bacteria 2984542743 2984543402 302
46 iso_pu_bacteria 8016254467 8016256463 302
47 iso_pu_bacteria 8046352972 8046353241 302
48 iso_pu_bacteria 8056037122 8056038423 302
49 3300038443 Ga0395901_0151898 Ga0395901_0151898_875_1798 303
50 3300044683 Ga0466965_0033666 Ga0466965_0033666_233_1153 303
51 3300044901 Ga0466960_0000352 Ga0466960_0000352_927_1847 303
52 3300005985 Ga0081539_10010927 Ga0081539_100109273 304
53 3300026121 Ga0207683_10085888 Ga0207683_100858882 304
54 3300044658 Ga0466972_0093849 Ga0466972_0093849_183_1097 304
55 3300044842 Ga0466957_0151929 Ga0466957_0151929_76_990 304
56 3300045836 Ga0466958_0184809 Ga0466958_0184809_83_997 304
57 3300045976 Ga0466967_0258804 Ga0466967_0258804_230_1144 304
58 3300048928 Ga0496125_0114724 Ga0496125_0114724_926_1843 304
59 3300053085 Ga0495619_0121046 Ga0495619_0121046_255_1184 304
60 3300005985 Ga0081539_10008014 Ga0081539_100080145 305
61 3300048917 Ga0496114_0066192 Ga0496114_0066192_364_1290 305
62 3300048922 Ga0496119_0127576 Ga0496119_0127576_444_1370 305
63 3300049575 Ga0501039_0163550 Ga0501039_0163550_390_1316 305
64 3300049578 Ga0501042_0023590 Ga0501042_0023590_581_1501 305
65 3300053077 Ga0495601_0027028 Ga0495601_0027028_1918_2853 305
66 3300053078 Ga0495612_0001227 Ga0495612_0001227_9592_10527 305
67 iso_pu_bacteria 2906799679 2906801757 305
68 3300005288 Ga0065714_10083917 Ga0065714_100839172 306
69 3300005328 Ga0070676_10148595 Ga0070676_101485951 306
70 3300009036 Ga0105244_10020969 Ga0105244_100209694 306
71 3300009036 Ga0105244_10159815 Ga0105244_101598151 306
72 3300025972 Ga0207668_10094494 Ga0207668_100944942 306
73 3300026095 Ga0207676_10541907 Ga0207676_105419072 306
74 3300031824 Ga0307413_10250027 Ga0307413_102500271 306
75 3300031852 Ga0307410_10389201 Ga0307410_103892012 306
76 3300031911 Ga0307412_10390377 Ga0307412_103903772 306
77 3300031911 Ga0307412_10443363 Ga0307412_104433631 306
78 3300032002 Ga0307416_100173519 Ga0307416_1001735191 306
79 3300044842 Ga0466957_0178018 Ga0466957_0178018_376_1305 306
80 3300044901 Ga0466960_0044157 Ga0466960_0044157_753_1727 306
81 3300045836 Ga0466958_0040643 Ga0466958_0040643_475_1398 306
82 3300045836 Ga0466958_0171190 Ga0466958_0171190_424_1353 306
83 3300045976 Ga0466967_0068475 Ga0466967_0068475_92_1021 306
84 3300046460 Ga0495638_0091906 Ga0495638_0091906_642_1565 306
85 3300048911 Ga0496108_0095198 Ga0496108_0095198_820_1749 306
86 3300048913 Ga0496110_0376912 Ga0496110_0376912_101_1030 306
87 3300048917 Ga0496114_0087338 Ga0496114_0087338_973_1902 306
88 3300048919 Ga0496116_0036093 Ga0496116_0036093_1964_2893 306
89 3300048920 Ga0496117_0000069 Ga0496117_0000069_186075_187004 306
90 3300048920 Ga0496117_0018350 Ga0496117_0018350_1540_2472 306
91 3300048921 Ga0496118_0087588 Ga0496118_0087588_215_1147 306
92 3300048922 Ga0496119_0000804 Ga0496119_0000804_20668_21597 306
93 3300048922 Ga0496119_0001501 Ga0496119_0001501_13674_14603 306
94 3300048922 Ga0496119_0002562 Ga0496119_0002562_1773_2702 306
95 3300048923 Ga0496120_0000577 Ga0496120_0000577_43612_44541 306
96 3300048923 Ga0496120_0001038 Ga0496120_0001038_34775_35704 306
97 3300048923 Ga0496120_0002197 Ga0496120_0002197_5417_6346 306
98 3300048925 Ga0496122_0000022 Ga0496122_0000022_141486_142415 306
99 3300048925 Ga0496122_0012793 Ga0496122_0012793_2103_3035 306
100 3300048925 Ga0496122_0226138 Ga0496122_0226138_127_1056 306
101 3300048926 Ga0496123_0000016 Ga0496123_0000016_188433_189362 306
102 3300048926 Ga0496123_0023178 Ga0496123_0023178_1353_2285 306
103 3300048926 Ga0496123_0054400 Ga0496123_0054400_1611_2540 306
104 3300048927 Ga0496124_0001871 Ga0496124_0001871_23278_24207 306
105 3300048927 Ga0496124_0024026 Ga0496124_0024026_2116_3045 306
106 3300048927 Ga0496124_0059280 Ga0496124_0059280_1797_2729 306
107 3300048928 Ga0496125_0003258 Ga0496125_0003258_13133_14062 306
108 3300048928 Ga0496125_0007450 Ga0496125_0007450_1162_2091 306
109 3300048929 Ga0496126_0003707 Ga0496126_0003707_4182_5111 306
110 3300049568 Ga0501031_0089615 Ga0501031_0089615_923_1846 306
111 3300049571 Ga0501034_0010872 Ga0501034_0010872_75_998 306
112 3300049573 Ga0501037_0008450 Ga0501037_0008450_888_1811 306
113 3300049574 Ga0501038_0006713 Ga0501038_0006713_8172_9095 306
114 3300049575 Ga0501039_0009772 Ga0501039_0009772_4457_5380 306
115 3300049579 Ga0501043_0032626 Ga0501043_0032626_1611_2534 306
116 3300049580 Ga0501046_0006812 Ga0501046_0006812_2942_3865 306
117 3300049582 Ga0501048_0051237 Ga0501048_0051237_2003_2926 306
118 3300049586 Ga0501070_0000637 Ga0501070_0000637_18335_19264 306
119 3300049586 Ga0501070_0053510 Ga0501070_0053510_2215_3138 306
120 3300049822 Ga0501035_0075338 Ga0501035_0075338_323_1246 306
121 3300049823 Ga0501044_0052477 Ga0501044_0052477_2278_3201 306
122 3300049824 Ga0501045_0042599 Ga0501045_0042599_2249_3172 306
123 iso_pu_bacteria 2643221649 2644278420 306
124 3300003320 rootH2_10062674 rootH2_100626744 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

16

273

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.8763 1 306
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8676 1 306
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8622 1 306
3c8n-assembly1.cif.gz_A crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.862 1 306
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8601 2 305
ID Description Score Start End Superfamily
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8761 25 306 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8601 2 305 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8514 3 297 3.20.20.30
af_P95159_1_299_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8498 1 287 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8496 2 305 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A6B3ETG4-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9916 191 298 GO:0016705
AF-A0A6B3ETG4-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9826 191 298 GO:0016705
AF-A0A511D1S1-F1-model_v4 Luciferase-like domain-containing protein 0.9764 196 306 GO:0016705
AF-A0A2S9FFK2-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9657 1 253 GO:0008726
GO:0046306
AF-A0A1H2K476-F1-model_v4 Probable F420-dependent oxidoreductase, Rv1855c family 0.9644 1 307 GO:0008726
GO:0046306

Feature Viewer

pLDDT pTM Quality
91.42 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map