F123404

General Info

Members Datasets Scaffolds Average Seq Length
124 62 248 203

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0458483|Ga0436360_0458483_337_1011
Length 224
Sequence MAPLLVDALLLGTSPVPNSRMKVGLFGGAFDPVHNAHLFIAEALRTSEGLDRVVFLPTGAGHHRSAPRASVDDRCAMLRAALAANPAFALDLSDTDESATGYTADLLPRMRLKYKGDELYFIVGGDSLVHGNWDRLDEILRLLDGFLVAPRGEVQQSDLAAALTAIPDGLRERVRLIEMPRVSGAATLVRERIEAGESVRYLVPEPVWRYIIEHHLYAPGAVPR

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
20 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
25 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 2.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 85.48
Stem 0
Stem Tuber 0
Unclassified 12.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0458483 3300039438 Unclassified 1332
2 Ga0070691_10003565 3300005341 Bacteria 7021
3 Ga0070661_100054882 3300005344 Bacteria 2918
4 Ga0070709_10540915 3300005434 Unclassified 890
5 Ga0070714_100007252 3300005435 Bacteria 8615
6 Ga0070714_100072868 3300005435 Bacteria 2974
7 Ga0070714_100449450 3300005435 Bacteria 1224
8 Ga0070714_100510506 3300005435 Bacteria 1147
9 Ga0070713_101072600 3300005436 Bacteria 778
10 Ga0070663_100236814 3300005455 Bacteria 1439
11 Ga0070679_100426607 3300005530 Bacteria 1271
12 Ga0068853_100042746 3300005539 Bacteria 3876
13 Ga0068855_100000344 3300005563 Bacteria 57763
14 Ga0068855_100016748 3300005563 Bacteria 8815
15 Ga0068854_100000002 3300005578 Bacteria 362695
16 Ga0068856_100002920 3300005614 Bacteria 17508
17 Ga0068852_100254229 3300005616 Bacteria 1684
18 Ga0070717_10257300 3300006028 Bacteria 1544
19 Ga0105240_10102340 3300009093 Bacteria 3481
20 Ga0105238_10242542 3300009551 Bacteria 1780
21 Ga0157374_10025304 3300013296 Bacteria 5327
22 Ga0157372_10688554 3300013307 Bacteria 1190
23 Ga0157376_10454864 3300014969 Bacteria 1250
24 Ga0206356_10844274 3300020070 Bacteria 10517
25 Ga0206353_11047528 3300020082 Unclassified 1163
26 Ga0213873_10007597 3300021358 Bacteria 2179
27 Ga0213873_10037013 3300021358 Bacteria 1241
28 Ga0213873_10053881 3300021358 Unclassified 1072
29 Ga0213872_10039875 3300021361 Bacteria 2143
30 Ga0213872_10056630 3300021361 Bacteria 1776
31 Ga0213872_10119951 3300021361 Bacteria 1163
32 Ga0213872_10220947 3300021361 Bacteria 806
33 Ga0213874_10005123 3300021377 Bacteria 3036
34 Ga0213874_10031049 3300021377 Bacteria 1544
35 Ga0213876_10000977 3300021384 Bacteria 18827
36 Ga0213876_10027040 3300021384 Unclassified 3027
37 Ga0213875_10000001 3300021388 Bacteria 2793540
38 Ga0213871_10009483 3300021441 Bacteria 2182
39 Ga0213871_10011784 3300021441 Bacteria 2016
40 Ga0207695_10076855 3300025913 Bacteria 3393
41 Ga0207649_10033053 3300025920 Bacteria 3088
42 Ga0207649_10171832 3300025920 Bacteria 1510
43 Ga0207652_10383367 3300025921 Bacteria 1268
44 Ga0207694_10346232 3300025924 Bacteria 1230
45 Ga0207664_10054322 3300025929 Bacteria 3173
46 Ga0207664_10102422 3300025929 Bacteria 2367
47 Ga0207664_10239704 3300025929 Bacteria 1579
48 Ga0207661_10099846 3300025944 Bacteria 2435
49 Ga0207667_10000161 3300025949 Bacteria 98927
50 Ga0207667_10003510 3300025949 Bacteria 19383
51 Ga0207640_10000006 3300025981 Bacteria 313289
52 Ga0207702_10005458 3300026078 Bacteria 11125
53 Ga0207698_10248381 3300026142 Bacteria 1626
54 Ga0265356_1000114 3300028017 Bacteria 13935
55 Ga0265338_10008076 3300028800 Bacteria 12864
56 Ga0265338_10136644 3300028800 Bacteria 1926
57 Ga0265338_10189278 3300028800 Unclassified 1561
58 Ga0265762_1001293 3300030760 Bacteria 4553
59 Ga0265325_10002169 3300031241 Bacteria 13384
60 Ga0265325_10032902 3300031241 Bacteria 2766
61 Ga0265325_10037648 3300031241 Bacteria 2556
62 Ga0265329_10018279 3300031242 Unclassified 2400
63 Ga0265339_10002779 3300031249 Bacteria 12448
64 Ga0265327_10026191 3300031251 Bacteria 3383
65 Ga0265316_10009830 3300031344 Bacteria 8777
66 Ga0265316_10226178 3300031344 Bacteria 1379
67 Ga0265313_10003347 3300031595 Bacteria 13096
68 Ga0265342_10000813 3300031712 Bacteria 31313
69 Ga0265342_10047350 3300031712 Bacteria 2580
70 Ga0395899_0006139 3300037312 Bacteria 9313
71 Ga0395900_0020688 3300037418 Bacteria 6724
72 Ga0395898_0004012 3300037466 Bacteria 16187
73 Ga0436364_0115970 3300037853 Bacteria 16388
74 Ga0436364_0148838 3300037853 Bacteria 1761
75 Ga0436364_0273345 3300037853 Bacteria 2794207
76 Ga0436364_1232957 3300037853 Bacteria 3551
77 Ga0395901_0162466 3300038443 Bacteria 2345
78 Ga0436365_0131875 3300039437 Bacteria 6302
79 Ga0436365_0177974 3300039437 Bacteria 19021
80 Ga0436365_1847041 3300039437 Bacteria 1632
81 Ga0436360_0057839 3300039438 Bacteria 5784
82 Ga0436360_0067262 3300039438 Bacteria 1454
83 Ga0436360_0077242 3300039438 Bacteria 5716
84 Ga0436360_0796113 3300039438 Bacteria 2139
85 Ga0436360_0939335 3300039438 Bacteria 1473
86 Ga0436360_1003729 3300039438 Bacteria 1625
87 Ga0436360_1245500 3300039438 Unclassified 2158
88 Ga0436360_1279636 3300039438 Bacteria 647
89 Ga0436360_1290824 3300039438 Bacteria 2583
90 Ga0436361_0329650 3300039447 Bacteria 2313
91 Ga0436361_0368595 3300039447 Bacteria 1763
92 Ga0436361_0372626 3300039447 Unclassified 703
93 Ga0436361_0434638 3300039447 Bacteria 42089
94 Ga0436361_0483784 3300039447 Bacteria 1452
95 Ga0436361_0576711 3300039447 Bacteria 25198
96 Ga0436361_0651954 3300039447 Bacteria 1608
97 Ga0436361_0924710 3300039447 Bacteria 13927
98 Ga0436361_1033044 3300039447 Bacteria 1615
99 Ga0436363_0461872 3300039450 Bacteria 118070
100 Ga0436363_0681690 3300039450 Bacteria 766
101 Ga0436363_0803952 3300039450 Bacteria 2145
102 Ga0436363_0873200 3300039450 Bacteria 1660
103 Ga0436363_1206432 3300039450 Bacteria 1898
104 Ga0436363_1398824 3300039450 Bacteria 1096
105 Ga0436362_0088721 3300039453 Unclassified 1168
106 Ga0436362_0307886 3300039453 Bacteria 1798
107 Ga0436362_0471455 3300039453 Unclassified 944
108 Ga0436362_0524553 3300039453 Bacteria 8733
109 Ga0436362_0659058 3300039453 Bacteria 1458
110 Ga0436362_1033931 3300039453 Unclassified 963
111 Ga0436362_1062883 3300039453 Bacteria 6603
112 Ga0436362_1096154 3300039453 Bacteria 3346
113 Ga0436362_1126568 3300039453 Unclassified 1163
114 Ga0436362_1147000 3300039453 Unclassified 2256
115 Ga0436362_1264595 3300039453 Bacteria 1566
116 Ga0466966_0075955 3300044684 Bacteria 2098
117 Ga0466963_0151610 3300044694 Unclassified 1610
118 Ga0466963_0338953 3300044694 Archaea 1058
119 Ga0466958_0009232 3300045836 Bacteria 5489
120 Ga0466958_0011304 3300045836 Bacteria 5026
121 Ga0466967_0000456 3300045976 Bacteria 19634
122 Ga0466967_0164600 3300045976 Bacteria 2084
123 Ga0495604_0231652 3300047317 Bacteria 1266
124 Ga0495612_0198623 3300053078 Bacteria 884
125 Ga0436360_0458483
126 Ga0070691_10003565
127 Ga0070661_100054882
128 Ga0070709_10540915
129 Ga0070714_100007252
130 Ga0070714_100072868
131 Ga0070714_100449450
132 Ga0070714_100510506
133 Ga0070713_101072600
134 Ga0070663_100236814
135 Ga0070679_100426607
136 Ga0068853_100042746
137 Ga0068855_100000344
138 Ga0068855_100016748
139 Ga0068854_100000002
140 Ga0068856_100002920
141 Ga0068852_100254229
142 Ga0070717_10257300
143 Ga0105240_10102340
144 Ga0105238_10242542
145 Ga0157374_10025304
146 Ga0157372_10688554
147 Ga0157376_10454864
148 Ga0206356_10844274
149 Ga0206353_11047528
150 Ga0213873_10007597
151 Ga0213873_10037013
152 Ga0213873_10053881
153 Ga0213872_10039875
154 Ga0213872_10056630
155 Ga0213872_10119951
156 Ga0213872_10220947
157 Ga0213874_10005123
158 Ga0213874_10031049
159 Ga0213876_10000977
160 Ga0213876_10027040
161 Ga0213875_10000001
162 Ga0213871_10009483
163 Ga0213871_10011784
164 Ga0207695_10076855
165 Ga0207649_10033053
166 Ga0207649_10171832
167 Ga0207652_10383367
168 Ga0207694_10346232
169 Ga0207664_10054322
170 Ga0207664_10102422
171 Ga0207664_10239704
172 Ga0207661_10099846
173 Ga0207667_10000161
174 Ga0207667_10003510
175 Ga0207640_10000006
176 Ga0207702_10005458
177 Ga0207698_10248381
178 Ga0265356_1000114
179 Ga0265338_10008076
180 Ga0265338_10136644
181 Ga0265338_10189278
182 Ga0265762_1001293
183 Ga0265325_10002169
184 Ga0265325_10032902
185 Ga0265325_10037648
186 Ga0265329_10018279
187 Ga0265339_10002779
188 Ga0265327_10026191
189 Ga0265316_10009830
190 Ga0265316_10226178
191 Ga0265313_10003347
192 Ga0265342_10000813
193 Ga0265342_10047350
194 Ga0395899_0006139
195 Ga0395900_0020688
196 Ga0395898_0004012
197 Ga0436364_0115970
198 Ga0436364_0148838
199 Ga0436364_0273345
200 Ga0436364_1232957
201 Ga0395901_0162466
202 Ga0436365_0131875
203 Ga0436365_0177974
204 Ga0436365_1847041
205 Ga0436360_0057839
206 Ga0436360_0067262
207 Ga0436360_0077242
208 Ga0436360_0796113
209 Ga0436360_0939335
210 Ga0436360_1003729
211 Ga0436360_1245500
212 Ga0436360_1279636
213 Ga0436360_1290824
214 Ga0436361_0329650
215 Ga0436361_0368595
216 Ga0436361_0372626
217 Ga0436361_0434638
218 Ga0436361_0483784
219 Ga0436361_0576711
220 Ga0436361_0651954
221 Ga0436361_0924710
222 Ga0436361_1033044
223 Ga0436363_0461872
224 Ga0436363_0681690
225 Ga0436363_0803952
226 Ga0436363_0873200
227 Ga0436363_1206432
228 Ga0436363_1398824
229 Ga0436362_0088721
230 Ga0436362_0307886
231 Ga0436362_0471455
232 Ga0436362_0524553
233 Ga0436362_0659058
234 Ga0436362_1033931
235 Ga0436362_1062883
236 Ga0436362_1096154
237 Ga0436362_1126568
238 Ga0436362_1147000
239 Ga0436362_1264595
240 Ga0466966_0075955
241 Ga0466963_0151610
242 Ga0466963_0338953
243 Ga0466958_0009232
244 Ga0466958_0011304
245 Ga0466967_0000456
246 Ga0466967_0164600
247 Ga0495604_0231652
248 Ga0495612_0198623

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

25

160

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1o-assembly1.cif.gz_A structure of mycobacterium tuberculosis nadd in complex with nadp 0.9104 1 197
1kaq-assembly3.cif.gz_E structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.9082 1 197
5das-assembly3.cif.gz_D structure of mycobacterium tuberculosis nadd in complex with nadp, p21212, form 2 0.9082 2 197
1kaq-assembly3.cif.gz_E structure of bacillus subtilis nicotinic acid mononucleotide adenylyl transferase 0.9033 1 197
5db4-assembly2.cif.gz_B mycobacterium abscessus nadd in complex with mg-atp, space group i41 0.9016 2 197
ID Description Score Start End Superfamily
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.885 2 197 3.40.50.620
5virA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8664 2 197 3.40.50.620
2h2aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8587 2 197 3.40.50.620
af_Q96T66_4_245_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8573 1 197 3.40.50.620
af_Q9VC03_45_291_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8427 1 200 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7Y3P4H8-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9803 1 202 GO:0004515
GO:0005524
GO:0009435
AF-A0A7Y3P4H8-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9755 1 202 GO:0004515
GO:0005524
GO:0009435
AF-A0A2W5XQ27-F1-model_v4 Probable nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Deamido-NAD(+) diphosphorylase) (Deamido-NAD(+) pyrophosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) 0.9511 2 201 GO:0004515
GO:0005524
GO:0009435
AF-A0A2V6MD80-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) 0.9424 2 110 GO:0004515
GO:0009435
AF-W4VMV1-F1-model_v4 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) 0.9334 2 110 GO:0009435
GO:0070566

Map