F121635

General Info

Members Datasets Scaffolds Average Seq Length
124 105 248 204

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100020867|Ga0070707_1000208672
Length 176
Sequence MTGWEISPFEPGGLRVAPLRPPVLPEPARHGERIGWIATRAAADEGIWVDDRWRLGRIAGVGVPLVLMLHPRDHYDTADLPDELAAGLGVLTAHIVRQEEALPHISRAHVYRIGDGARLHVWFFARPEGQAQLCGSWLVVWDDLLPEYPADAAEADAASVADALVASYGGRRSANS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
47 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
72 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
73 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
78 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
79 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
80 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
100 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
101 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
102 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
103 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
104 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
105 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0.81
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 4.03
Rhizosphere 86.29
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100020867 3300005468 Bacteria 6183
2 rootL2_10200814 3300003322 Bacteria 2570
3 rootL2_10274763 3300003322 Bacteria 2349
4 rootH1_10325659 3300003323 Bacteria 1460
5 Ga0070658_10035920 3300005327 Bacteria 3993
6 Ga0070660_100204341 3300005339 Bacteria 1603
7 Ga0070681_10055142 3300005458 Bacteria 3959
8 Ga0070679_100001650 3300005530 Bacteria 20104
9 Ga0070684_100863331 3300005535 Bacteria 847
10 Ga0068854_101213090 3300005578 Bacteria 676
11 Ga0068856_100649573 3300005614 Bacteria 1075
12 Ga0081455_10191306 3300005937 Bacteria 1540
13 Ga0081539_10217984 3300005985 Bacteria 870
14 Ga0075430_100562575 3300006846 Bacteria 940
15 Ga0105250_10075383 3300009092 Bacteria 1365
16 Ga0105240_10040597 3300009093 Bacteria 5949
17 Ga0105245_10108846 3300009098 Bacteria 2574
18 Ga0105245_11049825 3300009098 Bacteria 860
19 Ga0114129_10906769 3300009147 Bacteria 1116
20 Ga0105237_10257797 3300009545 Bacteria 1746
21 Ga0105249_11165080 3300009553 Bacteria 842
22 Ga0157370_10015495 3300013104 Bacteria 7751
23 Ga0157369_10020468 3300013105 Bacteria 7396
24 Ga0157378_10226235 3300013297 Bacteria 1780
25 Ga0157372_10000175 3300013307 Bacteria 71177
26 Ga0157372_11226138 3300013307 Bacteria 866
27 Ga0224712_10036226 3300022467 Bacteria 1827
28 Ga0207647_10129450 3300025904 Bacteria 1484
29 Ga0207705_10025881 3300025909 Bacteria 4187
30 Ga0207707_10062687 3300025912 Bacteria 3235
31 Ga0207695_10090067 3300025913 Bacteria 3083
32 Ga0207657_10175540 3300025919 Bacteria 1734
33 Ga0207652_10005541 3300025921 Bacteria 10236
34 Ga0207690_10145276 3300025932 Bacteria 1753
35 Ga0207708_10000081 3300026075 Bacteria 74669
36 Ga0307513_10093028 3300031456 Bacteria 3066
37 Ga0307516_10036069 3300031730 Bacteria 4953
38 Ga0307413_10453078 3300031824 Bacteria 1019
39 Ga0307409_100220736 3300031995 Bacteria 1711
40 Ga0307415_100038763 3300032126 Bacteria 3143
41 Ga0307415_100097069 3300032126 Bacteria 2150
42 Ga0373933_0354948 3300035724 Bacteria 953
43 Ga0395898_0137622 3300037466 Bacteria 2338
44 Ga0436364_0954797 3300037853 Bacteria 9011
45 Ga0395901_0339659 3300038443 Bacteria 1552
46 Ga0439449_0037653 3300042007 Bacteria 1799
47 Ga0466969_0038932 3300044656 Bacteria 2390
48 Ga0466969_0185296 3300044656 Bacteria 952
49 Ga0466966_0044899 3300044684 Bacteria 2827
50 Ga0466966_0245002 3300044684 Bacteria 1080
51 Ga0466961_0061567 3300044693 Bacteria 2385
52 Ga0466964_0674873 3300044706 Bacteria 574
53 Ga0466971_0062807 3300044719 Bacteria 1681
54 Ga0466971_0069649 3300044719 Bacteria 1596
55 Ga0466970_0029966 3300044765 Bacteria 2868
56 Ga0466957_0034277 3300044842 Bacteria 3046
57 Ga0466957_0587156 3300044842 Unclassified 779
58 Ga0466960_0028183 3300044901 Bacteria 2569
59 Ga0466959_0087800 3300045049 Bacteria 2236
60 Ga0466959_0133931 3300045049 Bacteria 1755
61 Ga0466958_0006348 3300045836 Bacteria 6428
62 Ga0466958_0177977 3300045836 Bacteria 1349
63 Ga0466958_0239940 3300045836 Bacteria 1158
64 Ga0466958_0262251 3300045836 Bacteria 1106
65 Ga0466967_0216493 3300045976 Bacteria 1818
66 Ga0466967_1047153 3300045976 Bacteria 813
67 Ga0495603_0214942 3300046455 Bacteria 1110
68 Ga0495590_0034712 3300046457 Bacteria 1761
69 Ga0495651_0001955 3300046462 Bacteria 15926
70 Ga0495651_0195890 3300046462 Bacteria 1418
71 Ga0495585_0199225 3300046492 Bacteria 1020
72 Ga0495618_0009223 3300046514 Bacteria 5959
73 Ga0495620_0022962 3300046515 Bacteria 2992
74 Ga0495628_0001240 3300046516 Bacteria 23338
75 Ga0495628_0040807 3300046516 Bacteria 3707
76 Ga0495643_0326580 3300046522 Bacteria 692
77 Ga0495652_0002342 3300046529 Bacteria 19650
78 Ga0495597_0083391 3300046542 Bacteria 1365
79 Ga0495645_0146352 3300046543 Bacteria 1645
80 Ga0495634_0249921 3300046642 Bacteria 1085
81 Ga0495625_0358811 3300046660 Bacteria 919
82 Ga0495635_0002144 3300046663 Bacteria 13393
83 Ga0495657_0004754 3300046675 Bacteria 10824
84 Ga0495657_0479613 3300046675 Bacteria 726
85 Ga0495646_0189755 3300046680 Bacteria 1124
86 Ga0495624_0104695 3300046690 Bacteria 1741
87 Ga0495649_0030480 3300046694 Bacteria 2979
88 Ga0495660_0034592 3300046810 Bacteria 2826
89 Ga0495581_0391945 3300047315 Bacteria 810
90 Ga0495604_0064091 3300047317 Bacteria 2802
91 Ga0495676_0266972 3300047321 Bacteria 1162
92 Ga0495680_0014510 3300047322 Bacteria 6820
93 Ga0495683_0051378 3300047323 Bacteria 2061
94 Ga0495687_014529 3300047443 Bacteria 4047
95 Ga0495593_0086100 3300047673 Bacteria 1621
96 Ga0495614_0097081 3300048089 Bacteria 1285
97 Ga0496101_0401914 3300048904 Bacteria 1079
98 Ga0496107_0574731 3300048910 Bacteria 834
99 Ga0496109_0306105 3300048912 Bacteria 1499
100 Ga0496110_0657667 3300048913 Bacteria 948
101 Ga0496115_0027269 3300048918 Bacteria 4466
102 Ga0501033_0010578 3300049570 Bacteria 7073
103 Ga0501036_0007744 3300049572 Bacteria 8779
104 Ga0501038_0021030 3300049574 Bacteria 5863
105 Ga0501039_0029971 3300049575 Bacteria 4192
106 Ga0501043_0001560 3300049579 Bacteria 19949
107 Ga0501046_0019391 3300049580 Bacteria 5642
108 Ga0501047_0102199 3300049581 Bacteria 2746
109 Ga0501047_0777250 3300049581 Bacteria 773
110 Ga0501070_0001146 3300049586 Bacteria 23760
111 Ga0501070_0262280 3300049586 Bacteria 1412
112 Ga0501070_0333429 3300049586 Bacteria 1233
113 Ga0501074_0071482 3300049590 Bacteria 2494
114 Ga0501035_0017443 3300049822 Bacteria 6621
115 Ga0501044_0912849 3300049823 Bacteria 753
116 nmdc:mga03n38_210065_c1 3300050490 Bacteria 1011
117 nmdc:mga05p37_1096728_c1 3300050507 Bacteria 834
118 Ga0500660_095816 3300053100 Bacteria 1310
119 Ga0500616_0000793 3300053153 Bacteria 36215
120 2753263807 2751185782 Bacteria 11227053
121 2772643880 2772190715 Bacteria 6959372
122 2918508686 2918501144 Bacteria 8668083
123 2995468201 2995463766 Bacteria 8577691
124 3006325183 3006321560 Bacteria 8247479
125 Ga0070707_100020867
126 rootL2_10200814
127 rootL2_10274763
128 rootH1_10325659
129 Ga0070658_10035920
130 Ga0070660_100204341
131 Ga0070681_10055142
132 Ga0070679_100001650
133 Ga0070684_100863331
134 Ga0068854_101213090
135 Ga0068856_100649573
136 Ga0081455_10191306
137 Ga0081539_10217984
138 Ga0075430_100562575
139 Ga0105250_10075383
140 Ga0105240_10040597
141 Ga0105245_10108846
142 Ga0105245_11049825
143 Ga0114129_10906769
144 Ga0105237_10257797
145 Ga0105249_11165080
146 Ga0157370_10015495
147 Ga0157369_10020468
148 Ga0157378_10226235
149 Ga0157372_10000175
150 Ga0157372_11226138
151 Ga0224712_10036226
152 Ga0207647_10129450
153 Ga0207705_10025881
154 Ga0207707_10062687
155 Ga0207695_10090067
156 Ga0207657_10175540
157 Ga0207652_10005541
158 Ga0207690_10145276
159 Ga0207708_10000081
160 Ga0307513_10093028
161 Ga0307516_10036069
162 Ga0307413_10453078
163 Ga0307409_100220736
164 Ga0307415_100038763
165 Ga0307415_100097069
166 Ga0373933_0354948
167 Ga0395898_0137622
168 Ga0436364_0954797
169 Ga0395901_0339659
170 Ga0439449_0037653
171 Ga0466969_0038932
172 Ga0466969_0185296
173 Ga0466966_0044899
174 Ga0466966_0245002
175 Ga0466961_0061567
176 Ga0466964_0674873
177 Ga0466971_0062807
178 Ga0466971_0069649
179 Ga0466970_0029966
180 Ga0466957_0034277
181 Ga0466957_0587156
182 Ga0466960_0028183
183 Ga0466959_0087800
184 Ga0466959_0133931
185 Ga0466958_0006348
186 Ga0466958_0177977
187 Ga0466958_0239940
188 Ga0466958_0262251
189 Ga0466967_0216493
190 Ga0466967_1047153
191 Ga0495603_0214942
192 Ga0495590_0034712
193 Ga0495651_0001955
194 Ga0495651_0195890
195 Ga0495585_0199225
196 Ga0495618_0009223
197 Ga0495620_0022962
198 Ga0495628_0001240
199 Ga0495628_0040807
200 Ga0495643_0326580
201 Ga0495652_0002342
202 Ga0495597_0083391
203 Ga0495645_0146352
204 Ga0495634_0249921
205 Ga0495625_0358811
206 Ga0495635_0002144
207 Ga0495657_0004754
208 Ga0495657_0479613
209 Ga0495646_0189755
210 Ga0495624_0104695
211 Ga0495649_0030480
212 Ga0495660_0034592
213 Ga0495581_0391945
214 Ga0495604_0064091
215 Ga0495676_0266972
216 Ga0495680_0014510
217 Ga0495683_0051378
218 Ga0495687_014529
219 Ga0495593_0086100
220 Ga0495614_0097081
221 Ga0496101_0401914
222 Ga0496107_0574731
223 Ga0496109_0306105
224 Ga0496110_0657667
225 Ga0496115_0027269
226 Ga0501033_0010578
227 Ga0501036_0007744
228 Ga0501038_0021030
229 Ga0501039_0029971
230 Ga0501043_0001560
231 Ga0501046_0019391
232 Ga0501047_0102199
233 Ga0501047_0777250
234 Ga0501070_0001146
235 Ga0501070_0262280
236 Ga0501070_0333429
237 Ga0501074_0071482
238 Ga0501035_0017443
239 Ga0501044_0912849
240 nmdc:mga03n38_210065_c1
241 nmdc:mga05p37_1096728_c1
242 Ga0500660_095816
243 Ga0500616_0000793
244 2753263807
245 2772643880
246 2918508686
247 2995468201
248 3006325183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oik-assembly2.cif.gz_D crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution 0.7735 62 193
1y23-assembly3.cif.gz_E crystal structure of a member of hit family of proteins from bacillus subtilis 0.7534 62 167
6id1-assembly1.cif.gz_U cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution 0.7401 73 155
4zgl-assembly2.cif.gz_D hit like protein 0.7388 65 153
3i4s-assembly1.cif.gz_B crystal structure of histidine triad protein blr8122 from bradyrhizobium japonicum 0.7372 67 187
ID Description Score Start End Superfamily
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8365 62 156 3.30.428.10
af_Q58276_1_129_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8295 63 156 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8151 73 153 3.30.428.10
af_A1Z8J0_315_438_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.814 73 158 3.30.428.10
af_Q09909_385_541_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7905 71 155 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A3S3T7A5-F1-model_v4 deleted 0.9135 76 200
AF-A0A0F0HMF0-F1-model_v4 Diadenosine tetraphosphate hydrolase 0.8899 73 199
AF-A0A0F0H567-F1-model_v4 Uncharacterized protein 0.8886 59 170
AF-A0A7W0P8Y5-F1-model_v4 HIT domain-containing protein 0.8764 88 194
AF-A0A0Q9RH92-F1-model_v4 HIT domain-containing protein 0.8733 73 191

Map