F119804

General Info

Members Datasets Scaffolds Average Seq Length
123 104 246 194

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0092197|Ga0495649_0092197_54_743
Length 229
Sequence MVWPWKNKGILLTVFLTAALYWIMNDLNIKAISGGKEMERCGWVNQDPLYIDYHDHEWGVPVYDDRLLFEYLNLEGAQAGLSWYTILKKRENYRKAFDQFEPAKIIHYDDEKIQELLSNEGIVRNRLKVNAVITNAKAYFEVVKEFGSFSNYIWSFVDGKPIQNFFREMKDVPASTEISERLSKDLKKRGFKFVGTTICYAFMQATGMVNDHIVSCHYSVKNTKGQLSF

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
56 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
81 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
82 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
83 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
84 2671180694 Paenibacillus sp. A3 Isolate Unclassified
85 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
86 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
87 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
88 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
89 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
90 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
91 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
92 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
93 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
94 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
95 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
96 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
97 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
98 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
99 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
100 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
101 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
102 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
103 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
104 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0
Isolates 17.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 0
Rhizoplane 3.25
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0092197 3300046694 Bacteria 1614
2 JGI25153J46596_10001762 3300003215 Bacteria 12827
3 rootH2_10093106 3300003320 Bacteria 4854
4 rootH1_10067361 3300003323 Bacteria 6357
5 JGI25160J50197_1003606 3300003354 Bacteria 6874
6 Ga0065165_1058896 3300005262 Bacteria 1059
7 Ga0065715_10150865 3300005293 Bacteria 1731
8 Ga0070676_10438204 3300005328 Bacteria 916
9 Ga0070668_100223458 3300005347 Bacteria 1554
10 Ga0070675_100165757 3300005354 Bacteria 1903
11 Ga0070667_100178902 3300005367 Bacteria 1875
12 Ga0070667_100479110 3300005367 Bacteria 1139
13 Ga0070700_100516305 3300005441 Bacteria 922
14 Ga0068867_100089234 3300005459 Bacteria 2338
15 Ga0070679_100015875 3300005530 Bacteria 7248
16 Ga0070695_100095684 3300005545 Bacteria 1991
17 Ga0070665_100000048 3300005548 Bacteria 265077
18 Ga0070664_100170158 3300005564 Bacteria 1932
19 Ga0068859_100151552 3300005617 Bacteria 2394
20 Ga0068864_100520983 3300005618 Bacteria 1146
21 Ga0068864_101204247 3300005618 Bacteria 756
22 Ga0068858_100001303 3300005842 Bacteria 25739
23 Ga0081455_10031523 3300005937 Bacteria 4794
24 Ga0097621_100000448 3300006237 Bacteria 28883
25 Ga0068871_100004499 3300006358 Bacteria 9709
26 Ga0075431_100301610 3300006847 Bacteria 1618
27 Ga0075434_100034384 3300006871 Bacteria 5005
28 Ga0097620_100151556 3300006931 Bacteria 2394
29 Ga0105240_10001796 3300009093 Bacteria 36115
30 Ga0114129_10026470 3300009147 Bacteria 8212
31 Ga0105249_10121642 3300009553 Bacteria 2481
32 Ga0157374_10002822 3300013296 Bacteria 14568
33 Ga0157378_10011103 3300013297 Bacteria 7883
34 Ga0163162_10020851 3300013306 Bacteria 6443
35 Ga0163162_10733157 3300013306 Bacteria 1108
36 Ga0163162_10798174 3300013306 Bacteria 1061
37 Ga0157379_10074382 3300014968 Bacteria 3042
38 Ga0163161_10040402 3300017792 Bacteria 3350
39 Ga0163161_10230960 3300017792 Bacteria 1436
40 Ga0209436_101249 3300025208 Bacteria 9158
41 Ga0209436_116942 3300025208 Bacteria 1079
42 Ga0209147_100142 3300025229 Bacteria 113692
43 Ga0209147_107586 3300025229 Bacteria 1400
44 Ga0209129_1014900 3300025258 Bacteria 1630
45 Ga0209130_1001800 3300025284 Bacteria 12550
46 Ga0209130_1032108 3300025284 Bacteria 1073
47 Ga0209758_1004196 3300025297 Bacteria 12227
48 Ga0207426_1001193 3300025302 Bacteria 23085
49 Ga0207426_1001587 3300025302 Bacteria 18222
50 Ga0207426_1023511 3300025302 Bacteria 2101
51 Ga0207645_10401184 3300025907 Bacteria 922
52 Ga0207695_10044894 3300025913 Bacteria 4696
53 Ga0207652_10257271 3300025921 Bacteria 1575
54 Ga0207712_10459602 3300025961 Bacteria 1081
55 Ga0207658_10168376 3300025986 Bacteria 1802
56 Ga0207658_11052780 3300025986 Bacteria 743
57 Ga0207703_10002214 3300026035 Bacteria 17059
58 Ga0207678_10043022 3300026067 Bacteria 3909
59 Ga0207702_10098636 3300026078 Bacteria 2574
60 Ga0207641_10002398 3300026088 Bacteria 17296
61 Ga0207648_10149629 3300026089 Bacteria 2060
62 Ga0207676_11467430 3300026095 Bacteria 679
63 Ga0207674_10279540 3300026116 Bacteria 1617
64 Ga0307405_10454110 3300031731 Bacteria 1017
65 Ga0307416_100198761 3300032002 Bacteria 1900
66 Ga0373945_0162480 3300035116 Unclassified 911
67 Ga0373931_0035919 3300035691 Bacteria 2580
68 Ga0395899_0150700 3300037312 Bacteria 1648
69 Ga0451577_0000182 3300042876 Bacteria 133479
70 Ga0451577_0095146 3300042876 Bacteria 2660
71 Ga0466969_0008122 3300044656 Bacteria 5571
72 Ga0466961_0052140 3300044693 Bacteria 2611
73 Ga0453684_0000038 3300044712 Bacteria 706970
74 Ga0453684_0609321 3300044712 Bacteria 1196
75 Ga0466968_0043689 3300044735 Bacteria 1898
76 Ga0466959_0002211 3300045049 Bacteria 12385
77 Ga0466959_0077563 3300045049 Bacteria 2397
78 Ga0451576_0485938 3300045051 Bacteria 1297
79 Ga0466958_0171426 3300045836 Bacteria 1374
80 Ga0466967_1736943 3300045976 Bacteria 621
81 Ga0495580_0430669 3300046472 Bacteria 887
82 Ga0495622_0032425 3300046557 Bacteria 2439
83 Ga0495589_0200916 3300046794 Bacteria 941
84 Ga0495636_0184545 3300047318 Bacteria 948
85 Ga0495626_0159702 3300048091 Bacteria 946
86 Ga0496105_0323479 3300048908 Bacteria 1236
87 Ga0496110_0397841 3300048913 Unclassified 1256
88 Ga0496112_0078227 3300048915 Bacteria 3271
89 Ga0496112_0371791 3300048915 Bacteria 1371
90 Ga0496116_0152056 3300048919 Bacteria 1283
91 Ga0496121_0000020 3300048924 Bacteria 498732
92 nmdc:mga05p37_15712_c1 3300050507 Bacteria 9100
93 nmdc:mga05p37_317612_c1 3300050507 Bacteria 1845
94 nmdc:mga09592_388968_c1 3300050508 Bacteria 1206
95 nmdc:mga06r32_1021704_c1 3300050510 Bacteria 779
96 nmdc:mga06r32_289512_c1 3300050510 Bacteria 1625
97 nmdc:mga0n895_136156_c1 3300050512 Bacteria 2483
98 nmdc:mga0n895_32688_c1 3300050512 Bacteria 4995
99 nmdc:mga0rr50_21982_c1 3300050513 Bacteria 4368
100 nmdc:mga08x19_452629_c1 3300050514 Bacteria 904
101 nmdc:mga08x19_73348_c1 3300050514 Bacteria 2234
102 Ga0500568_0084818 3300053139 Bacteria 1199
103 2673819599 2671180694 Bacteria 7506943
104 2745166588 2744054657 Bacteria 5016802
105 2817619047 2816332336 Bacteria 5207640
106 2857465510 2857460504 Bacteria 5194327
107 2864998886 2864997549 Bacteria 5139696
108 2883072951 2883068021 Bacteria 6192739
109 2888583037 2888578766 Bacteria 6743310
110 2889300598 2889295896 Bacteria 4704906
111 2929923437 2929921140 Bacteria 8649150
112 2936365879 2936361878 Bacteria 5632809
113 2977257849 2977254563 Bacteria 4828420
114 2980126411 2980125574 Bacteria 5567337
115 2981287486 2981284811 Bacteria 4641497
116 2981292682 2981289755 Bacteria 4641509
117 2981983103 2981980479 Bacteria 4641628
118 2981988015 2981985349 Bacteria 4641497
119 2990278876 2990275345 Bacteria 4887158
120 3001892971 3001892409 Bacteria 6328293
121 3006975186 3006973921 Bacteria 4423788
122 8003152841 8003151029 Bacteria 8187759
123 8055635391 8055632911 Bacteria 5283357
124 Ga0495649_0092197
125 JGI25153J46596_10001762
126 rootH2_10093106
127 rootH1_10067361
128 JGI25160J50197_1003606
129 Ga0065165_1058896
130 Ga0065715_10150865
131 Ga0070676_10438204
132 Ga0070668_100223458
133 Ga0070675_100165757
134 Ga0070667_100178902
135 Ga0070667_100479110
136 Ga0070700_100516305
137 Ga0068867_100089234
138 Ga0070679_100015875
139 Ga0070695_100095684
140 Ga0070665_100000048
141 Ga0070664_100170158
142 Ga0068859_100151552
143 Ga0068864_100520983
144 Ga0068864_101204247
145 Ga0068858_100001303
146 Ga0081455_10031523
147 Ga0097621_100000448
148 Ga0068871_100004499
149 Ga0075431_100301610
150 Ga0075434_100034384
151 Ga0097620_100151556
152 Ga0105240_10001796
153 Ga0114129_10026470
154 Ga0105249_10121642
155 Ga0157374_10002822
156 Ga0157378_10011103
157 Ga0163162_10020851
158 Ga0163162_10733157
159 Ga0163162_10798174
160 Ga0157379_10074382
161 Ga0163161_10040402
162 Ga0163161_10230960
163 Ga0209436_101249
164 Ga0209436_116942
165 Ga0209147_100142
166 Ga0209147_107586
167 Ga0209129_1014900
168 Ga0209130_1001800
169 Ga0209130_1032108
170 Ga0209758_1004196
171 Ga0207426_1001193
172 Ga0207426_1001587
173 Ga0207426_1023511
174 Ga0207645_10401184
175 Ga0207695_10044894
176 Ga0207652_10257271
177 Ga0207712_10459602
178 Ga0207658_10168376
179 Ga0207658_11052780
180 Ga0207703_10002214
181 Ga0207678_10043022
182 Ga0207702_10098636
183 Ga0207641_10002398
184 Ga0207648_10149629
185 Ga0207676_11467430
186 Ga0207674_10279540
187 Ga0307405_10454110
188 Ga0307416_100198761
189 Ga0373945_0162480
190 Ga0373931_0035919
191 Ga0395899_0150700
192 Ga0451577_0000182
193 Ga0451577_0095146
194 Ga0466969_0008122
195 Ga0466961_0052140
196 Ga0453684_0000038
197 Ga0453684_0609321
198 Ga0466968_0043689
199 Ga0466959_0002211
200 Ga0466959_0077563
201 Ga0451576_0485938
202 Ga0466958_0171426
203 Ga0466967_1736943
204 Ga0495580_0430669
205 Ga0495622_0032425
206 Ga0495589_0200916
207 Ga0495636_0184545
208 Ga0495626_0159702
209 Ga0496105_0323479
210 Ga0496110_0397841
211 Ga0496112_0078227
212 Ga0496112_0371791
213 Ga0496116_0152056
214 Ga0496121_0000020
215 nmdc:mga05p37_15712_c1
216 nmdc:mga05p37_317612_c1
217 nmdc:mga09592_388968_c1
218 nmdc:mga06r32_1021704_c1
219 nmdc:mga06r32_289512_c1
220 nmdc:mga0n895_136156_c1
221 nmdc:mga0n895_32688_c1
222 nmdc:mga0rr50_21982_c1
223 nmdc:mga08x19_452629_c1
224 nmdc:mga08x19_73348_c1
225 Ga0500568_0084818
226 2673819599
227 2745166588
228 2817619047
229 2857465510
230 2864998886
231 2883072951
232 2888583037
233 2889300598
234 2929923437
235 2936365879
236 2977257849
237 2980126411
238 2981287486
239 2981292682
240 2981983103
241 2981988015
242 2990278876
243 3001892971
244 3006975186
245 8003152841
246 8055635391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

43

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9807 6 184
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9729 7 186
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9696 7 189
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9596 6 184
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9553 7 189
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.983 6 183 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9748 6 187 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9659 7 189 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9542 6 187 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9457 7 189 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A496W327-F1-model_v4 DNA-3-methyladenine glycosylase I 1.001 6 184 GO:0006284
GO:0008725
GO:0046872
AF-A0A7V1PWT8-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9986 4 163 GO:0006284
GO:0008725
GO:0046872
AF-A0A1G0C007-F1-model_v4 DNA-3-methyladenine glycosylase 0.9983 6 188 GO:0006284
GO:0008725
GO:0046872
AF-A0A1F4AVK4-F1-model_v4 DNA-3-methyladenine glycosylase 0.9983 29 188 GO:0006284
GO:0008725
GO:0046872
AF-A0A0S7YVZ2-F1-model_v4 DNA-3-methyladenine glycosylase 0.9982 6 186 GO:0006284
GO:0008725
GO:0046872

Map