F119335

General Info

Members Datasets Scaffolds Average Seq Length
123 68 246 252

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0235535|Ga0436360_0235535_89_919
Length 276
Sequence MNDSGAFSYPPAVRVRDLVYRYPDGEEALRGVNLEVQSGQCVALVGPNGAGKSTLLLHLNGLLPGRQRDEPRHHHGLDLAWTARNGRRPPSVWIDGIEVSPRNAYQVRRKVGLLFQDPDDQLFGTTVLEDVAFGPLNQGQSAAQAKDRALECLDRVELRHLANRPPHHLSFGERKRVCLAGILACQPSVLVLDEPTANLDPRGRRRFIELIGSLSTTTLTATHDLEMVLAMCPRAILLDKGAVVADGPSREVLGDAALLTEHDLELPISLSLSRPT

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
4 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
5 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
6 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
7 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
8 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
9 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
10 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
14 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
15 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
16 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
17 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
18 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
19 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
22 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
23 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
24 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
25 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
26 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
27 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
30 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
31 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
32 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
33 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
34 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
35 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
36 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
37 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
38 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
39 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
40 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
47 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
48 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
49 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
50 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
54 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
56 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
57 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
58 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
61 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
62 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
63 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
64 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
65 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
66 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
67 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
68 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.12
Metatranscriptomes 1.63
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0235535 3300039438 Bacteria 1030
2 Ga0065704_10002259 3300005289 Bacteria 5546
3 Ga0068858_100036860 3300005842 Bacteria 4534
4 Ga0075431_100089587 3300006847 Bacteria 3175
5 Ga0075433_10051994 3300006852 Bacteria 3569
6 Ga0105240_10001819 3300009093 Bacteria 35782
7 Ga0114129_10914725 3300009147 Bacteria 1111
8 Ga0105248_10510483 3300009177 Bacteria 1355
9 Ga0157376_10164148 3300014969 Bacteria 2016
10 Ga0207695_10007053 3300025913 Bacteria 14411
11 Ga0207670_10597282 3300025936 Bacteria 906
12 Ga0207711_10094201 3300025941 Bacteria 2639
13 Ga0265337_1007153 3300028556 Bacteria 4208
14 Ga0265337_1016070 3300028556 Bacteria 2431
15 Ga0265337_1030506 3300028556 Unclassified 1605
16 Ga0265337_1033844 3300028556 Bacteria 1506
17 Ga0265326_10056800 3300028558 Unclassified 1107
18 Ga0265318_10032101 3300028577 Bacteria 2034
19 Ga0265323_10000304 3300028653 Bacteria 28435
20 Ga0265323_10012780 3300028653 Unclassified 3359
21 Ga0265323_10013601 3300028653 Bacteria 3242
22 Ga0265323_10015896 3300028653 Bacteria 2949
23 Ga0265323_10021861 3300028653 Bacteria 2448
24 Ga0265323_10062807 3300028653 Bacteria 1287
25 Ga0265338_10000196 3300028800 Bacteria 114348
26 Ga0265338_10003130 3300028800 Bacteria 23634
27 Ga0265338_10026024 3300028800 Bacteria 5916
28 Ga0265338_10060501 3300028800 Bacteria 3327
29 Ga0265338_10068906 3300028800 Bacteria 3044
30 Ga0265338_10110713 3300028800 Bacteria 2213
31 Ga0265338_10136206 3300028800 Bacteria 1930
32 Ga0265338_10205683 3300028800 Unclassified 1481
33 Ga0265324_10000124 3300029957 Bacteria 61275
34 Ga0265324_10021891 3300029957 Bacteria 2290
35 Ga0265762_1017804 3300030760 Bacteria 1294
36 Ga0265760_10004960 3300031090 Bacteria 3807
37 Ga0265330_10000450 3300031235 Bacteria 27518
38 Ga0265330_10000809 3300031235 Bacteria 19744
39 Ga0265330_10014532 3300031235 Bacteria 3653
40 Ga0265330_10026108 3300031235 Bacteria 2645
41 Ga0265330_10031538 3300031235 Bacteria 2375
42 Ga0265330_10095118 3300031235 Bacteria 1277
43 Ga0265332_10113433 3300031238 Bacteria 1140
44 Ga0265328_10051002 3300031239 Bacteria 1519
45 Ga0265325_10003784 3300031241 Bacteria 9766
46 Ga0265329_10000236 3300031242 Bacteria 29389
47 Ga0265329_10018348 3300031242 Bacteria 2395
48 Ga0265329_10026838 3300031242 Bacteria 1895
49 Ga0265340_10002336 3300031247 Bacteria 10832
50 Ga0265340_10015611 3300031247 Bacteria 3945
51 Ga0265340_10124166 3300031247 Bacteria 1186
52 Ga0265339_10002902 3300031249 Bacteria 12135
53 Ga0265339_10218571 3300031249 Bacteria 933
54 Ga0265327_10021207 3300031251 Unclassified 3926
55 Ga0265327_10031475 3300031251 Bacteria 2980
56 Ga0265316_10000035 3300031344 Bacteria 150658
57 Ga0265316_10000235 3300031344 Bacteria 63962
58 Ga0265316_10010573 3300031344 Bacteria 8397
59 Ga0265316_10019478 3300031344 Bacteria 5803
60 Ga0265316_10032321 3300031344 Bacteria 4270
61 Ga0265316_10035458 3300031344 Bacteria 4043
62 Ga0265316_10054315 3300031344 Unclassified 3136
63 Ga0265316_10086406 3300031344 Bacteria 2397
64 Ga0265316_10129324 3300031344 Bacteria 1903
65 Ga0265316_10168904 3300031344 Bacteria 1632
66 Ga0265316_10180022 3300031344 Bacteria 1574
67 Ga0265316_10181288 3300031344 Bacteria 1568
68 Ga0265316_10249063 3300031344 Bacteria 1305
69 Ga0265316_10500054 3300031344 Bacteria 868
70 Ga0265314_10000150 3300031711 Bacteria 104182
71 Ga0265314_10010064 3300031711 Bacteria 7928
72 Ga0265314_10042928 3300031711 Bacteria 3221
73 Ga0265314_10058020 3300031711 Bacteria 2654
74 Ga0265314_10066657 3300031711 Bacteria 2427
75 Ga0265342_10000703 3300031712 Bacteria 34958
76 Ga0265342_10000793 3300031712 Bacteria 31894
77 Ga0265342_10002792 3300031712 Bacteria 14775
78 Ga0265342_10014274 3300031712 Bacteria 5278
79 Ga0265342_10016807 3300031712 Bacteria 4770
80 Ga0265342_10092584 3300031712 Bacteria 1731
81 Ga0373926_0043671 3300035083 Bacteria 1604
82 Ga0373945_0105239 3300035116 Bacteria 1108
83 Ga0373943_0117831 3300035170 Bacteria 1408
84 Ga0373924_0051206 3300035410 Bacteria 1712
85 Ga0373935_0096690 3300035692 Bacteria 1941
86 Ga0373927_0005422 3300035695 Bacteria 8802
87 Ga0373947_0006953 3300035725 Bacteria 6557
88 Ga0373937_0019716 3300036401 Bacteria 6040
89 Ga0373925_0008877 3300037068 Bacteria 7324
90 Ga0451577_0000880 3300042876 Bacteria 44582
91 Ga0466972_0127909 3300044658 Bacteria 1197
92 Ga0453683_0352710 3300044673 Bacteria 945
93 Ga0453684_0000068 3300044712 Bacteria 461699
94 Ga0453684_0001435 3300044712 Bacteria 68004
95 Ga0453684_0002793 3300044712 Bacteria 41283
96 Ga0453684_0275495 3300044712 Bacteria 1921
97 Ga0451576_0212487 3300045051 Bacteria 2020
98 Ga0495628_0272019 3300046516 Bacteria 1260
99 Ga0495630_0073127 3300046517 Bacteria 2581
100 Ga0495613_0078639 3300046689 Bacteria 2399
101 Ga0495684_0464451 3300047471 Unclassified 877
102 Ga0501034_0003886 3300049571 Bacteria 16808
103 Ga0501043_0013151 3300049579 Bacteria 6473
104 Ga0501043_0067744 3300049579 Bacteria 2803
105 Ga0501046_0000017 3300049580 Bacteria 229617
106 Ga0501047_0013600 3300049581 Bacteria 7718
107 Ga0501048_0005727 3300049582 Bacteria 9443
108 Ga0501079_0376155 3300049741 Bacteria 1113
109 Ga0501080_0026510 3300049742 Bacteria 5385
110 Ga0501083_0000020 3300049744 Bacteria 143667
111 Ga0501035_0264595 3300049822 Bacteria 1457
112 Ga0501044_0056182 3300049823 Bacteria 4041
113 Ga0501044_0232959 3300049823 Bacteria 1788
114 Ga0501045_0070876 3300049824 Bacteria 2565
115 Ga0501045_0074206 3300049824 Bacteria 2505
116 nmdc:mga09592_396900_c1 3300050508 Archaea 1192
117 nmdc:mga08x19_657564_c1 3300050514 Bacteria 743
118 nmdc:mga0a205_50827_c1 3300050515 Bacteria 4002
119 Ga0501082_0048624 3300060353 Bacteria 3656
120 2688067017 2687453257 Bacteria 6784659
121 2739365166 2738543034 Bacteria 6084756
122 2889419716 2889415604 Bacteria 8048700
123 2920114459 2920107658 Bacteria 10042636
124 Ga0436360_0235535
125 Ga0065704_10002259
126 Ga0068858_100036860
127 Ga0075431_100089587
128 Ga0075433_10051994
129 Ga0105240_10001819
130 Ga0114129_10914725
131 Ga0105248_10510483
132 Ga0157376_10164148
133 Ga0207695_10007053
134 Ga0207670_10597282
135 Ga0207711_10094201
136 Ga0265337_1007153
137 Ga0265337_1016070
138 Ga0265337_1030506
139 Ga0265337_1033844
140 Ga0265326_10056800
141 Ga0265318_10032101
142 Ga0265323_10000304
143 Ga0265323_10012780
144 Ga0265323_10013601
145 Ga0265323_10015896
146 Ga0265323_10021861
147 Ga0265323_10062807
148 Ga0265338_10000196
149 Ga0265338_10003130
150 Ga0265338_10026024
151 Ga0265338_10060501
152 Ga0265338_10068906
153 Ga0265338_10110713
154 Ga0265338_10136206
155 Ga0265338_10205683
156 Ga0265324_10000124
157 Ga0265324_10021891
158 Ga0265762_1017804
159 Ga0265760_10004960
160 Ga0265330_10000450
161 Ga0265330_10000809
162 Ga0265330_10014532
163 Ga0265330_10026108
164 Ga0265330_10031538
165 Ga0265330_10095118
166 Ga0265332_10113433
167 Ga0265328_10051002
168 Ga0265325_10003784
169 Ga0265329_10000236
170 Ga0265329_10018348
171 Ga0265329_10026838
172 Ga0265340_10002336
173 Ga0265340_10015611
174 Ga0265340_10124166
175 Ga0265339_10002902
176 Ga0265339_10218571
177 Ga0265327_10021207
178 Ga0265327_10031475
179 Ga0265316_10000035
180 Ga0265316_10000235
181 Ga0265316_10010573
182 Ga0265316_10019478
183 Ga0265316_10032321
184 Ga0265316_10035458
185 Ga0265316_10054315
186 Ga0265316_10086406
187 Ga0265316_10129324
188 Ga0265316_10168904
189 Ga0265316_10180022
190 Ga0265316_10181288
191 Ga0265316_10249063
192 Ga0265316_10500054
193 Ga0265314_10000150
194 Ga0265314_10010064
195 Ga0265314_10042928
196 Ga0265314_10058020
197 Ga0265314_10066657
198 Ga0265342_10000703
199 Ga0265342_10000793
200 Ga0265342_10002792
201 Ga0265342_10014274
202 Ga0265342_10016807
203 Ga0265342_10092584
204 Ga0373926_0043671
205 Ga0373945_0105239
206 Ga0373943_0117831
207 Ga0373924_0051206
208 Ga0373935_0096690
209 Ga0373927_0005422
210 Ga0373947_0006953
211 Ga0373937_0019716
212 Ga0373925_0008877
213 Ga0451577_0000880
214 Ga0466972_0127909
215 Ga0453683_0352710
216 Ga0453684_0000068
217 Ga0453684_0001435
218 Ga0453684_0002793
219 Ga0453684_0275495
220 Ga0451576_0212487
221 Ga0495628_0272019
222 Ga0495630_0073127
223 Ga0495613_0078639
224 Ga0495684_0464451
225 Ga0501034_0003886
226 Ga0501043_0013151
227 Ga0501043_0067744
228 Ga0501046_0000017
229 Ga0501047_0013600
230 Ga0501048_0005727
231 Ga0501079_0376155
232 Ga0501080_0026510
233 Ga0501083_0000020
234 Ga0501035_0264595
235 Ga0501044_0056182
236 Ga0501044_0232959
237 Ga0501045_0070876
238 Ga0501045_0074206
239 nmdc:mga09592_396900_c1
240 nmdc:mga08x19_657564_c1
241 nmdc:mga0a205_50827_c1
242 Ga0501082_0048624
243 2688067017
244 2739365166
245 2889419716
246 2920114459

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

197

0.91

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

128

229

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9461 1 241
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.941 2 241
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9397 2 237
5x41-assembly1.cif.gz_A 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9376 1 240
8bmp-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp 0.9375 2 241
ID Description Score Start End Superfamily
5x41A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9376 1 240 3.40.50.300
af_Q2FUT2_290_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9368 1 237 3.40.50.300
af_Q2FW34_4_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9342 2 238 3.40.50.300
4mkiB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.927 2 239 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9161 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A518CPL6-F1-model_v4 Cobalt import ATP-binding protein CbiO (EC 3.6.3.-) 0.9866 1 241 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A0S7B9W9-F1-model_v4 ABC-type cobalt transport system, ATPase component 0.9851 2 235 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A7C3LVM6-F1-model_v4 ABC transporter ATP-binding protein 0.9828 78 219 GO:0005524
GO:0016887
GO:0042626
GO:0043190
AF-A0A1V5RYW4-F1-model_v4 ABC transporter ATP-binding protein 0.9823 2 235 GO:0005524
GO:0006824
GO:0016887
GO:0042626
GO:0043190
AF-A0A524IWD1-F1-model_v4 ABC transporter ATP-binding protein 0.9823 2 237 GO:0005524
GO:0016887
GO:0042626
GO:0043190

Map