F117383

General Info

Members Datasets Scaffolds Average Seq Length
123 82 246 195

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100011336|Ga0070714_1000113365
Length 204
Sequence MTSDDFEKPDPILSADVSGGASESLSAEDTVARLEKEVADLKDRLLRALAETENVRRRGDREREETAKYAVTGFARDVLPVADNLGRALAAIGPESRGKDPGLDALIAGIELTDRDLKTTFERNGIRRIDPMGERFDHNFHQAMMEVEDPTKAPGTVVQVLQAGYVLRDRLLRPAMVAVSRGGKSDAAVEPEAQDAGHTVDTKA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
46 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
47 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
48 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
49 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
50 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
51 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
52 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
53 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
82 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.81
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 86.18
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100011336 3300005435 Bacteria 7070
2 JGI24740J21852_10016009 3300001979 Bacteria 2722
3 Ga0070658_10651354 3300005327 Bacteria 914
4 Ga0070666_10142626 3300005335 Bacteria 1669
5 Ga0070680_100002233 3300005336 Bacteria 14285
6 Ga0070680_100008421 3300005336 Bacteria 7900
7 Ga0070680_100215192 3300005336 Bacteria 1621
8 Ga0070709_10398871 3300005434 Bacteria 1027
9 Ga0070714_100006103 3300005435 Bacteria 9257
10 Ga0070714_100171326 3300005435 Bacteria 1970
11 Ga0070713_100002651 3300005436 Bacteria 11657
12 Ga0070713_100233006 3300005436 Bacteria 1674
13 Ga0070710_10000578 3300005437 Bacteria 17393
14 Ga0070710_10131993 3300005437 Bacteria 1524
15 Ga0070711_100002269 3300005439 Bacteria 10899
16 Ga0070711_100264926 3300005439 Bacteria 1354
17 Ga0070662_100159950 3300005457 Bacteria 1761
18 Ga0070681_10004373 3300005458 Bacteria 13443
19 Ga0070681_11134129 3300005458 Bacteria 703
20 Ga0070706_100157360 3300005467 Bacteria 2121
21 Ga0070698_100016911 3300005471 Bacteria 7691
22 Ga0070698_100370260 3300005471 Bacteria 1365
23 Ga0070699_100090533 3300005518 Bacteria 2674
24 Ga0068855_100570347 3300005563 Bacteria 1223
25 Ga0070717_10007795 3300006028 Bacteria 7969
26 Ga0070717_10078373 3300006028 Bacteria 2769
27 Ga0070716_100179330 3300006173 Bacteria 1389
28 Ga0070712_100003151 3300006175 Bacteria 10161
29 Ga0070712_100035820 3300006175 Bacteria 3371
30 Ga0070712_100941621 3300006175 Bacteria 746
31 Ga0075433_10998860 3300006852 Bacteria 729
32 Ga0105240_10205127 3300009093 Bacteria 2308
33 Ga0105240_10613789 3300009093 Bacteria 1196
34 Ga0105247_10450410 3300009101 Bacteria 928
35 Ga0105248_10522615 3300009177 Bacteria 1338
36 Ga0105239_11259994 3300010375 Bacteria 853
37 Ga0157370_10219995 3300013104 Bacteria 1759
38 Ga0157379_10242339 3300014968 Bacteria 1635
39 Ga0157376_10411062 3300014969 Bacteria 1311
40 Ga0213873_10138321 3300021358 Bacteria 726
41 Ga0213872_10098316 3300021361 Bacteria 1306
42 Ga0213875_10001894 3300021388 Bacteria 12938
43 Ga0213875_10005867 3300021388 Bacteria 6527
44 Ga0213875_10146467 3300021388 Bacteria 1106
45 Ga0224712_10085185 3300022467 Bacteria 1313
46 Ga0207680_10152279 3300025903 Bacteria 1543
47 Ga0207699_10006493 3300025906 Bacteria 5669
48 Ga0207684_10411976 3300025910 Bacteria 1161
49 Ga0207707_10328183 3300025912 Bacteria 1320
50 Ga0207695_10827565 3300025913 Bacteria 806
51 Ga0207693_10000768 3300025915 Bacteria 28844
52 Ga0207693_10321236 3300025915 Bacteria 1212
53 Ga0207693_10742372 3300025915 Bacteria 759
54 Ga0207663_10002372 3300025916 Bacteria 9049
55 Ga0207652_10278735 3300025921 Bacteria 1508
56 Ga0207700_10003124 3300025928 Bacteria 9565
57 Ga0207700_10020242 3300025928 Bacteria 4514
58 Ga0207700_10579880 3300025928 Bacteria 997
59 Ga0207664_10000696 3300025929 Bacteria 23011
60 Ga0207664_10003377 3300025929 Bacteria 10618
61 Ga0207644_10041825 3300025931 Bacteria 3244
62 Ga0207665_10226585 3300025939 Bacteria 1372
63 Ga0207658_10416542 3300025986 Bacteria 1184
64 Ga0207428_10559880 3300027907 Bacteria 826
65 Ga0373926_0158614 3300035083 Bacteria 863
66 Ga0373951_0159567 3300035091 Bacteria 637
67 Ga0373932_0121108 3300035112 Bacteria 873
68 Ga0373936_0130604 3300035113 Bacteria 1079
69 Ga0373956_0043757 3300035119 Bacteria 1994
70 Ga0373957_0016001 3300035120 Bacteria 2591
71 Ga0373943_0162012 3300035170 Bacteria 1218
72 Ga0373943_0223814 3300035170 Bacteria 1049
73 Ga0373946_0043065 3300035171 Bacteria 1859
74 Ga0373955_0130100 3300035172 Bacteria 1469
75 Ga0373931_0607078 3300035691 Bacteria 716
76 Ga0373927_0647936 3300035695 Bacteria 698
77 Ga0373947_0126860 3300035725 Bacteria 1626
78 Ga0373947_0279097 3300035725 Bacteria 1110
79 Ga0373937_0758024 3300036401 Bacteria 918
80 Ga0395899_0001176 3300037312 Bacteria 23086
81 Ga0395900_0001377 3300037418 Bacteria 29258
82 Ga0395900_0120356 3300037418 Bacteria 2694
83 Ga0395900_0754774 3300037418 Bacteria 903
84 Ga0395898_0003355 3300037466 Bacteria 17968
85 Ga0395905_0069737 3300037471 Bacteria 3293
86 Ga0436364_0072008 3300037853 Bacteria 1291
87 Ga0436364_0167149 3300037853 Bacteria 26449
88 Ga0436364_0231267 3300037853 Unclassified 725
89 Ga0436364_0423915 3300037853 Bacteria 1979
90 Ga0436364_0759376 3300037853 Bacteria 3859
91 Ga0436364_1356723 3300037853 Bacteria 99137
92 Ga0436364_1412781 3300037853 Bacteria 8112
93 Ga0395901_0001507 3300038443 Bacteria 24210
94 Ga0395901_0350398 3300038443 Bacteria 1524
95 Ga0436365_0035070 3300039437 Bacteria 1433
96 Ga0436365_0706877 3300039437 Bacteria 752
97 Ga0436365_1102840 3300039437 Bacteria 4165
98 Ga0436365_1500678 3300039437 Bacteria 600
99 Ga0436360_0325330 3300039438 Bacteria 1568
100 Ga0436360_0370366 3300039438 Bacteria 871
101 Ga0436360_1110089 3300039438 Bacteria 4225
102 Ga0436361_0705981 3300039447 Bacteria 2734
103 Ga0436361_0994125 3300039447 Bacteria 2948
104 Ga0436361_1014586 3300039447 Bacteria 1235
105 Ga0436363_1677044 3300039450 Bacteria 4584
106 Ga0436363_1709173 3300039450 Bacteria 4122
107 Ga0436362_0231435 3300039453 Bacteria 2171
108 Ga0436362_1081545 3300039453 Bacteria 3913
109 Ga0436362_1259973 3300039453 Bacteria 2109
110 Ga0466963_0051326 3300044694 Bacteria 2734
111 Ga0466957_0938298 3300044842 Bacteria 620
112 Ga0466967_1248886 3300045976 Unclassified 740
113 Ga0495580_0264729 3300046472 Bacteria 1175
114 Ga0495586_0029515 3300046535 Bacteria 2935
115 Ga0495667_0181294 3300046559 Bacteria 1351
116 Ga0495635_0317280 3300046663 Bacteria 1043
117 Ga0495599_0249199 3300046678 Bacteria 1081
118 Ga0495600_0047542 3300046809 Bacteria 2799
119 Ga0495680_0177496 3300047322 Bacteria 1539
120 Ga0501080_0437314 3300049742 Bacteria 1174
121 nmdc:mga08y16_974064_c1 3300050511 Bacteria 830
122 Ga0495619_0019856 3300053085 Bacteria 4276
123 2524611576 2524023250 Bacteria 5457705
124 Ga0070714_100011336
125 JGI24740J21852_10016009
126 Ga0070658_10651354
127 Ga0070666_10142626
128 Ga0070680_100002233
129 Ga0070680_100008421
130 Ga0070680_100215192
131 Ga0070709_10398871
132 Ga0070714_100006103
133 Ga0070714_100171326
134 Ga0070713_100002651
135 Ga0070713_100233006
136 Ga0070710_10000578
137 Ga0070710_10131993
138 Ga0070711_100002269
139 Ga0070711_100264926
140 Ga0070662_100159950
141 Ga0070681_10004373
142 Ga0070681_11134129
143 Ga0070706_100157360
144 Ga0070698_100016911
145 Ga0070698_100370260
146 Ga0070699_100090533
147 Ga0068855_100570347
148 Ga0070717_10007795
149 Ga0070717_10078373
150 Ga0070716_100179330
151 Ga0070712_100003151
152 Ga0070712_100035820
153 Ga0070712_100941621
154 Ga0075433_10998860
155 Ga0105240_10205127
156 Ga0105240_10613789
157 Ga0105247_10450410
158 Ga0105248_10522615
159 Ga0105239_11259994
160 Ga0157370_10219995
161 Ga0157379_10242339
162 Ga0157376_10411062
163 Ga0213873_10138321
164 Ga0213872_10098316
165 Ga0213875_10001894
166 Ga0213875_10005867
167 Ga0213875_10146467
168 Ga0224712_10085185
169 Ga0207680_10152279
170 Ga0207699_10006493
171 Ga0207684_10411976
172 Ga0207707_10328183
173 Ga0207695_10827565
174 Ga0207693_10000768
175 Ga0207693_10321236
176 Ga0207693_10742372
177 Ga0207663_10002372
178 Ga0207652_10278735
179 Ga0207700_10003124
180 Ga0207700_10020242
181 Ga0207700_10579880
182 Ga0207664_10000696
183 Ga0207664_10003377
184 Ga0207644_10041825
185 Ga0207665_10226585
186 Ga0207658_10416542
187 Ga0207428_10559880
188 Ga0373926_0158614
189 Ga0373951_0159567
190 Ga0373932_0121108
191 Ga0373936_0130604
192 Ga0373956_0043757
193 Ga0373957_0016001
194 Ga0373943_0162012
195 Ga0373943_0223814
196 Ga0373946_0043065
197 Ga0373955_0130100
198 Ga0373931_0607078
199 Ga0373927_0647936
200 Ga0373947_0126860
201 Ga0373947_0279097
202 Ga0373937_0758024
203 Ga0395899_0001176
204 Ga0395900_0001377
205 Ga0395900_0120356
206 Ga0395900_0754774
207 Ga0395898_0003355
208 Ga0395905_0069737
209 Ga0436364_0072008
210 Ga0436364_0167149
211 Ga0436364_0231267
212 Ga0436364_0423915
213 Ga0436364_0759376
214 Ga0436364_1356723
215 Ga0436364_1412781
216 Ga0395901_0001507
217 Ga0395901_0350398
218 Ga0436365_0035070
219 Ga0436365_0706877
220 Ga0436365_1102840
221 Ga0436365_1500678
222 Ga0436360_0325330
223 Ga0436360_0370366
224 Ga0436360_1110089
225 Ga0436361_0705981
226 Ga0436361_0994125
227 Ga0436361_1014586
228 Ga0436363_1677044
229 Ga0436363_1709173
230 Ga0436362_0231435
231 Ga0436362_1081545
232 Ga0436362_1259973
233 Ga0466963_0051326
234 Ga0466957_0938298
235 Ga0466967_1248886
236 Ga0495580_0264729
237 Ga0495586_0029515
238 Ga0495667_0181294
239 Ga0495635_0317280
240 Ga0495599_0249199
241 Ga0495600_0047542
242 Ga0495680_0177496
243 Ga0501080_0437314
244 nmdc:mga08y16_974064_c1
245 Ga0495619_0019856
246 2524611576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

16

181

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ani-assembly1.cif.gz_B structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.8137 29 184
4ani-assembly1.cif.gz_B structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.8002 29 184
4ani-assembly1.cif.gz_F structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.7822 29 180
4ani-assembly1.cif.gz_F structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.7624 29 180
1dkg-assembly1.cif.gz_B crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.7605 30 184
ID Description Score Start End Superfamily
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.997 128 182 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9905 128 184 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9875 128 182 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9736 128 184 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9685 128 187 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A6M0F663-F1-model_v4 Protein GrpE 0.9685 104 186 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A402FET6-F1-model_v4 deleted 0.9442 76 186
AF-A0A235BPQ6-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9331 27 187 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A523DP17-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9204 40 187 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A7X7G0N0-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9165 34 187 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Map