F115395

General Info

Members Datasets Scaffolds Average Seq Length
122 82 244 349

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0169762|Ga0451577_0169762_168_1409
Length 413
Sequence MDNENPPAAPGSAGPGVSTPKPDTNPTSFTHAANPPTPPPVMPSYGPAVEGGAPRARRAGRGWMYVALILFVLLAFSVLLNIGALVESFAGSIGSISGQSHVVHRVTGPRFDEVIREDNGSRNKVALVAIDGVIFGGALDPGGFSMVDYVKAELNRAGEDGRVKAVILRIDSPGGEVLASDEIYRAIADFQEETGKPVVASMGNLAASGGYYVAAPCQWIVANELTITGSIGVMMRSWNYRNLMDKVGVVPQTFKSGKFKDMLSSEKKPEDILPEERAMVQSLIDETYTRFKEVVRDGRSNAAELNLKGKQKNRTLVDDWEEYADGRIFSGSEAYKLGFVDELGNFEDAFARARALAGIDDANIIEYRQRYDFSDFFRMFGKSEAKTVKLDLGVEMPKLEAGTLYFLSQHVAW

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
75 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0169762 3300042876 Unclassified 1966
2 rootH2_10145948 3300003320 Bacteria 3367
3 rootL2_10174190 3300003322 Bacteria 1655
4 rootH1_10028417 3300003323 Bacteria 7212
5 Ga0070683_100415460 3300005329 Bacteria 1283
6 Ga0070689_100005175 3300005340 Bacteria 8876
7 Ga0070691_10067809 3300005341 Bacteria 1726
8 Ga0070688_100081898 3300005365 Unclassified 2091
9 Ga0070701_10001142 3300005438 Bacteria 9693
10 Ga0070681_10022495 3300005458 Bacteria 6330
11 Ga0070685_10024191 3300005466 Bacteria 3334
12 Ga0070686_100003599 3300005544 Bacteria 8502
13 Ga0070686_100020903 3300005544 Bacteria 3881
14 Ga0070704_100032503 3300005549 Bacteria 3520
15 Ga0068855_100091519 3300005563 Bacteria 3508
16 Ga0068855_100128213 3300005563 Bacteria 2899
17 Ga0068857_100022895 3300005577 Bacteria 5497
18 Ga0068856_100000089 3300005614 Bacteria 85631
19 Ga0070702_100189510 3300005615 Bacteria 1352
20 Ga0068859_100029092 3300005617 Bacteria 5545
21 Ga0068859_100455398 3300005617 Bacteria 1376
22 Ga0068863_100055660 3300005841 Bacteria 3745
23 Ga0097621_100163723 3300006237 Unclassified 1913
24 Ga0068871_100094754 3300006358 Bacteria 2492
25 Ga0075428_100004212 3300006844 Bacteria 15847
26 Ga0097620_100029091 3300006931 Bacteria 5545
27 Ga0097620_100455397 3300006931 Bacteria 1376
28 Ga0105240_10001485 3300009093 Bacteria 39911
29 Ga0105240_10010081 3300009093 Bacteria 13299
30 Ga0105240_10027836 3300009093 Bacteria 7396
31 Ga0105240_10053420 3300009093 Bacteria 5070
32 Ga0105240_10081018 3300009093 Bacteria 3990
33 Ga0111539_10012719 3300009094 Bacteria 10541
34 Ga0105245_10061058 3300009098 Bacteria 3397
35 Ga0105238_10006530 3300009551 Bacteria 11613
36 Ga0105249_10263743 3300009553 Bacteria 1713
37 Ga0157375_10199264 3300013308 Unclassified 2157
38 Ga0163163_10075011 3300014325 Bacteria 3375
39 Ga0163163_10312579 3300014325 Bacteria 1624
40 Ga0157376_10067732 3300014969 Bacteria 3020
41 Ga0207707_10036092 3300025912 Bacteria 4322
42 Ga0207695_10016035 3300025913 Bacteria 8793
43 Ga0207695_10058291 3300025913 Bacteria 4009
44 Ga0207695_10215960 3300025913 Bacteria 1827
45 Ga0207687_10098183 3300025927 Unclassified 2150
46 Ga0207670_10001756 3300025936 Bacteria 11342
47 Ga0207667_10033875 3300025949 Bacteria 5488
48 Ga0207667_10190112 3300025949 Bacteria 2107
49 Ga0207667_10293507 3300025949 Bacteria 1661
50 Ga0207639_10135129 3300026041 Bacteria 2047
51 Ga0207702_10003046 3300026078 Bacteria 15575
52 Ga0207702_10069515 3300026078 Bacteria 3028
53 Ga0207641_10049482 3300026088 Bacteria 3552
54 Ga0207674_10026540 3300026116 Bacteria 6148
55 Ga0207674_10258812 3300026116 Bacteria 1687
56 Ga0265319_1015230 3300028563 Unclassified 2987
57 Ga0265334_10014349 3300028573 Unclassified 3304
58 Ga0265318_10006653 3300028577 Bacteria 5304
59 Ga0265338_10000016 3300028800 Bacteria 347424
60 Ga0265338_10000591 3300028800 Bacteria 63954
61 Ga0265338_10003656 3300028800 Bacteria 21417
62 Ga0265338_10004896 3300028800 Bacteria 17822
63 Ga0265338_10006668 3300028800 Bacteria 14600
64 Ga0265338_10009359 3300028800 Bacteria 11700
65 Ga0265338_10041235 3300028800 Bacteria 4321
66 Ga0265338_10049369 3300028800 Bacteria 3815
67 Ga0265338_10049699 3300028800 Bacteria 3798
68 Ga0265338_10117291 3300028800 Bacteria 2130
69 Ga0265324_10036479 3300029957 Bacteria 1709
70 Ga0265320_10043235 3300031240 Bacteria 2228
71 Ga0265325_10001230 3300031241 Bacteria 18246
72 Ga0265327_10004406 3300031251 Bacteria 12489
73 Ga0265327_10021066 3300031251 Bacteria 3946
74 Ga0265316_10007653 3300031344 Bacteria 10136
75 Ga0265316_10042860 3300031344 Bacteria 3613
76 Ga0265313_10004522 3300031595 Bacteria 10617
77 Ga0265314_10000876 3300031711 Bacteria 35825
78 Ga0265314_10017884 3300031711 Bacteria 5551
79 Ga0265314_10032337 3300031711 Bacteria 3849
80 Ga0307412_10070293 3300031911 Unclassified 2386
81 Ga0307409_100258085 3300031995 Unclassified 1598
82 Ga0373954_0004092 3300035118 Bacteria 6251
83 Ga0373956_0001548 3300035119 Bacteria 9490
84 Ga0373933_0087908 3300035724 Bacteria 1915
85 Ga0373937_0360333 3300036401 Unclassified 1378
86 Ga0373925_0009511 3300037068 Bacteria 7077
87 Ga0451577_0018015 3300042876 Bacteria 6511
88 Ga0451577_0019149 3300042876 Bacteria 6297
89 Ga0453684_0000655 3300044712 Bacteria 124610
90 Ga0453684_0009858 3300044712 Bacteria 16536
91 Ga0453684_0027613 3300044712 Bacteria 8131
92 Ga0453684_0062673 3300044712 Bacteria 4761
93 Ga0453684_0191132 3300044712 Bacteria 2395
94 Ga0451576_0119060 3300045051 Bacteria 2749
95 Ga0451576_0170383 3300045051 Bacteria 2272
96 Ga0451576_0381466 3300045051 Bacteria 1477
97 Ga0495592_0000081 3300046454 Bacteria 83319
98 Ga0495629_0018127 3300046459 Bacteria 5044
99 Ga0495618_0004438 3300046514 Bacteria 8633
100 Ga0495618_0127197 3300046514 Unclassified 1631
101 Ga0495628_0000198 3300046516 Bacteria 52820
102 Ga0495630_0002934 3300046517 Bacteria 11853
103 Ga0495630_0062516 3300046517 Bacteria 2797
104 Ga0495640_0092729 3300046533 Bacteria 1992
105 Ga0495586_0002967 3300046535 Bacteria 9143
106 Ga0495586_0009685 3300046535 Bacteria 5130
107 Ga0495645_0001083 3300046543 Bacteria 18447
108 Ga0495622_0006256 3300046557 Bacteria 5525
109 Ga0495635_0020946 3300046663 Bacteria 4556
110 Ga0495599_0071202 3300046678 Unclassified 2170
111 Ga0495658_0049893 3300046683 Bacteria 2365
112 Ga0495669_0093040 3300046684 Bacteria 1394
113 Ga0495613_0163923 3300046689 Bacteria 1580
114 Ga0495624_0008389 3300046690 Bacteria 7208
115 Ga0495674_0071336 3300047319 Unclassified 2999
116 Ga0495680_0007709 3300047322 Bacteria 9829
117 Ga0495675_0113546 3300047444 Bacteria 1690
118 Ga0496107_0124544 3300048910 Bacteria 1900
119 Ga0501047_0311694 3300049581 Bacteria 1414
120 nmdc:mga09592_137135_c1 3300050508 Bacteria 2107
121 nmdc:mga08y16_161528_c1 3300050511 Unclassified 2328
122 nmdc:mga08y16_367446_c1 3300050511 Unclassified 1476
123 Ga0451577_0169762
124 rootH2_10145948
125 rootL2_10174190
126 rootH1_10028417
127 Ga0070683_100415460
128 Ga0070689_100005175
129 Ga0070691_10067809
130 Ga0070688_100081898
131 Ga0070701_10001142
132 Ga0070681_10022495
133 Ga0070685_10024191
134 Ga0070686_100003599
135 Ga0070686_100020903
136 Ga0070704_100032503
137 Ga0068855_100091519
138 Ga0068855_100128213
139 Ga0068857_100022895
140 Ga0068856_100000089
141 Ga0070702_100189510
142 Ga0068859_100029092
143 Ga0068859_100455398
144 Ga0068863_100055660
145 Ga0097621_100163723
146 Ga0068871_100094754
147 Ga0075428_100004212
148 Ga0097620_100029091
149 Ga0097620_100455397
150 Ga0105240_10001485
151 Ga0105240_10010081
152 Ga0105240_10027836
153 Ga0105240_10053420
154 Ga0105240_10081018
155 Ga0111539_10012719
156 Ga0105245_10061058
157 Ga0105238_10006530
158 Ga0105249_10263743
159 Ga0157375_10199264
160 Ga0163163_10075011
161 Ga0163163_10312579
162 Ga0157376_10067732
163 Ga0207707_10036092
164 Ga0207695_10016035
165 Ga0207695_10058291
166 Ga0207695_10215960
167 Ga0207687_10098183
168 Ga0207670_10001756
169 Ga0207667_10033875
170 Ga0207667_10190112
171 Ga0207667_10293507
172 Ga0207639_10135129
173 Ga0207702_10003046
174 Ga0207702_10069515
175 Ga0207641_10049482
176 Ga0207674_10026540
177 Ga0207674_10258812
178 Ga0265319_1015230
179 Ga0265334_10014349
180 Ga0265318_10006653
181 Ga0265338_10000016
182 Ga0265338_10000591
183 Ga0265338_10003656
184 Ga0265338_10004896
185 Ga0265338_10006668
186 Ga0265338_10009359
187 Ga0265338_10041235
188 Ga0265338_10049369
189 Ga0265338_10049699
190 Ga0265338_10117291
191 Ga0265324_10036479
192 Ga0265320_10043235
193 Ga0265325_10001230
194 Ga0265327_10004406
195 Ga0265327_10021066
196 Ga0265316_10007653
197 Ga0265316_10042860
198 Ga0265313_10004522
199 Ga0265314_10000876
200 Ga0265314_10017884
201 Ga0265314_10032337
202 Ga0307412_10070293
203 Ga0307409_100258085
204 Ga0373954_0004092
205 Ga0373956_0001548
206 Ga0373933_0087908
207 Ga0373937_0360333
208 Ga0373925_0009511
209 Ga0451577_0018015
210 Ga0451577_0019149
211 Ga0453684_0000655
212 Ga0453684_0009858
213 Ga0453684_0027613
214 Ga0453684_0062673
215 Ga0453684_0191132
216 Ga0451576_0119060
217 Ga0451576_0170383
218 Ga0451576_0381466
219 Ga0495592_0000081
220 Ga0495629_0018127
221 Ga0495618_0004438
222 Ga0495618_0127197
223 Ga0495628_0000198
224 Ga0495630_0002934
225 Ga0495630_0062516
226 Ga0495640_0092729
227 Ga0495586_0002967
228 Ga0495586_0009685
229 Ga0495645_0001083
230 Ga0495622_0006256
231 Ga0495635_0020946
232 Ga0495599_0071202
233 Ga0495658_0049893
234 Ga0495669_0093040
235 Ga0495613_0163923
236 Ga0495624_0008389
237 Ga0495674_0071336
238 Ga0495680_0007709
239 Ga0495675_0113546
240 Ga0496107_0124544
241 Ga0501047_0311694
242 nmdc:mga09592_137135_c1
243 nmdc:mga08y16_161528_c1
244 nmdc:mga08y16_367446_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

190

360

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rst-assembly1.cif.gz_C crystal structure of bacillus subtilis signal peptide peptidase a 0.7988 71 317
3rst-assembly1.cif.gz_H crystal structure of bacillus subtilis signal peptide peptidase a 0.7984 71 316
3rst-assembly1.cif.gz_B crystal structure of bacillus subtilis signal peptide peptidase a 0.7979 71 315
3rst-assembly1.cif.gz_A crystal structure of bacillus subtilis signal peptide peptidase a 0.7956 69 316
3rst-assembly1.cif.gz_A crystal structure of bacillus subtilis signal peptide peptidase a 0.7923 69 316
ID Description Score Start End Superfamily
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8641 69 305 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8465 71 331 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8038 71 331 3.90.226.10
af_A4I828_502_737_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7959 94 150 3.40.50.300
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7939 69 305 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2M7YYF2-F1-model_v4 Signal peptide peptidase SppA 0.8701 47 168 GO:0006508
GO:0008236
AF-A0A6L7SA79-F1-model_v4 S49 family peptidase 0.8644 69 168 GO:0006508
GO:0008233
AF-A0A7J9GVC3-F1-model_v4 Peptidase S49 domain-containing protein 0.8538 69 181 GO:0006508
GO:0008236
AF-A0A7X3HER4-F1-model_v4 Signal peptide peptidase SppA 0.8492 82 171 GO:0006508
GO:0008233
AF-A0A2E0GF94-F1-model_v4 S49 family peptidase 0.837 70 188 GO:0006508
GO:0008236

Map