F112206

General Info

Members Datasets Scaffolds Average Seq Length
121 107 242 313

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862993130|2862993522
Length 337
Sequence QDVLRADRPTGRRDGGPDSGRSSRGPRGPRGSRGSRGGSGARRRAGLTPAALLVPSAVVLIVVVGYPLVTLLVMSFQEFGRAQAFGAPAPFVGFDNYVRVLTDSTFWTVLIRSLAFCAVNVAATMTLGTLLALLMQRLGRFLRLLVSVGLLLAWAMPALTAVIVWGWMFDTQFGVINHLLTVLTGTDFANHSWLIDPLSFFLVATVIITWQSVPFVAFTVYAGLTQVPDEVLEAAQLDGAGPVARFRLIVFPYLKSIFLVVTVLQVIWDLRVFTQIFALQGIGGIREQTSTIGVYIYQTSLAGGEYGTGGAIAVLLVILMLAISLYYVRATLKEDES

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
20 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
21 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
22 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
23 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
27 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
28 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
29 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
30 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
31 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
32 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
33 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
34 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
35 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
36 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
37 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
38 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
39 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
40 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
41 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
42 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
43 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
44 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
45 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
46 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
51 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
52 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
53 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
54 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
57 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
58 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
59 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
60 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
61 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
62 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
63 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
64 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
65 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
66 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
67 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
68 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
69 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
70 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
71 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
72 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
73 2643221549 Agromyces sp. Root1464 Isolate Unclassified
74 2643221566 Microbacterium sp. Root166 Isolate Unclassified
75 2643221575 Microbacterium sp. Root61 Isolate Unclassified
76 2643221597 Microbacterium sp. Root180 Isolate Unclassified
77 2643221617 Nocardioides sp. Root79 Isolate Unclassified
78 2643221620 Nocardioides sp. Root240 Isolate Unclassified
79 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
80 2643221679 Angustibacter sp. Root456 Isolate Unclassified
81 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
82 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
83 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
84 2738541305 Nocardioides sp. CF167 Isolate Unclassified
85 2773857759 Microbacterium sp. 1294 Isolate Unclassified
86 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
87 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
88 2808606372 Agromyces sp. 23-23 Isolate Unclassified
89 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
90 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
91 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
92 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
93 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
94 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
95 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
96 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
97 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
98 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
99 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
100 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
101 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
102 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
103 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
104 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
105 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
106 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
107 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.42
Metatranscriptomes 0
Isolates 30.58

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 23.14
Nodule 0
Rhizoplane 3.31
Rhizosphere 47.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10196087 3300003322 Bacteria 1989
2 Ga0068869_100164498 3300005334 Bacteria 1729
3 Ga0070671_100036400 3300005355 Bacteria 4082
4 Ga0070710_10034814 3300005437 Bacteria 2742
5 Ga0070707_100156772 3300005468 Bacteria 2218
6 Ga0070672_100506130 3300005543 Bacteria 1045
7 Ga0068861_100252109 3300005719 Bacteria 1506
8 Ga0075365_10005630 3300006038 Bacteria 6781
9 Ga0075365_10020633 3300006038 Bacteria 4089
10 Ga0075368_10038326 3300006042 Bacteria 1876
11 Ga0075363_100042579 3300006048 Bacteria 2400
12 Ga0075363_100220403 3300006048 Bacteria 1087
13 Ga0075364_10004828 3300006051 Bacteria 7805
14 Ga0075364_10016016 3300006051 Bacteria 4657
15 Ga0075367_10035729 3300006178 Bacteria 2878
16 Ga0075369_10010580 3300006186 Bacteria 3611
17 Ga0111539_10113977 3300009094 Bacteria 3170
18 Ga0207692_10200239 3300025898 Bacteria 1173
19 Ga0207688_10049175 3300025901 Bacteria 2356
20 Ga0207646_10150740 3300025922 Bacteria 2097
21 Ga0207675_100025498 3300026118 Bacteria 5503
22 Ga0209813_10036366 3300027866 Bacteria 1479
23 Ga0265340_10000166 3300031247 Bacteria 33210
24 Ga0307413_10049911 3300031824 Bacteria 2511
25 Ga0307406_10000236 3300031901 Bacteria 33679
26 Ga0307406_10023600 3300031901 Bacteria 3662
27 Ga0307409_100642054 3300031995 Bacteria 1054
28 Ga0307416_100449236 3300032002 Bacteria 1341
29 Ga0395900_0213867 3300037418 Bacteria 1946
30 Ga0439465_0047603 3300041413 Bacteria 1398
31 Ga0451791_1207242 3300041451 Bacteria 1468
32 Ga0466972_0031060 3300044658 Bacteria 2629
33 Ga0466965_0021069 3300044683 Bacteria 3137
34 Ga0466970_0005646 3300044765 Bacteria 6213
35 Ga0466960_0203391 3300044901 Bacteria 1083
36 Ga0466967_0061710 3300045976 Bacteria 3326
37 Ga0495638_0032429 3300046460 Bacteria 3349
38 Ga0495654_0060016 3300046530 Bacteria 1829
39 Ga0496108_0325704 3300048911 Bacteria 1340
40 Ga0496114_0092118 3300048917 Bacteria 2575
41 Ga0496114_0149238 3300048917 Bacteria 2028
42 Ga0496117_0000387 3300048920 Bacteria 75589
43 Ga0496119_0003920 3300048922 Bacteria 15097
44 Ga0496120_0005149 3300048923 Bacteria 10564
45 Ga0496121_0197414 3300048924 Bacteria 1437
46 Ga0496122_0004879 3300048925 Bacteria 16291
47 Ga0496125_0001233 3300048928 Bacteria 38274
48 Ga0496126_0053444 3300048929 Bacteria 3665
49 Ga0496126_0058633 3300048929 Bacteria 3469
50 Ga0501032_0312659 3300049569 Bacteria 1015
51 Ga0501034_0066113 3300049571 Bacteria 3628
52 Ga0501037_0102077 3300049573 Bacteria 2069
53 Ga0501040_0417962 3300049576 Bacteria 964
54 Ga0501043_0008520 3300049579 Bacteria 8077
55 Ga0501047_0016971 3300049581 Bacteria 6961
56 Ga0501069_0016917 3300049585 Bacteria 3919
57 Ga0501070_0001420 3300049586 Bacteria 21451
58 Ga0501070_0024911 3300049586 Bacteria 5018
59 Ga0501070_0469599 3300049586 Bacteria 1013
60 Ga0501071_0001998 3300049587 Bacteria 12189
61 Ga0501072_0389501 3300049588 Bacteria 1106
62 Ga0501073_0009038 3300049589 Bacteria 7357
63 Ga0501076_0320935 3300049592 Bacteria 1270
64 Ga0501080_0000023 3300049742 Bacteria 90345
65 nmdc:mga00v17_11866_c1 3300050491 Bacteria 4795
66 nmdc:mga00v17_69618_c1 3300050491 Bacteria 2178
67 nmdc:mga00v17_7206_c1 3300050491 Bacteria 5924
68 nmdc:mga0yw44_10081_c1 3300050492 Bacteria 4810
69 nmdc:mga0yw44_63304_c1 3300050492 Bacteria 2274
70 nmdc:mga06z11_3092_c1 3300050494 Bacteria 6415
71 nmdc:mga06r32_325530_c1 3300050510 Bacteria 1522
72 nmdc:mga08y16_130267_c1 3300050511 Bacteria 2616
73 nmdc:mga0sz30_29272_c1 3300050516 Bacteria 2269
74 Ga0500556_0001518 3300053104 Bacteria 9561
75 Ga0500593_038995 3300053117 Bacteria 2124
76 Ga0500655_010342 3300053133 Bacteria 1684
77 Ga0500559_0000847 3300053136 Bacteria 19728
78 Ga0500559_0003455 3300053136 Bacteria 7761
79 Ga0500568_0002050 3300053139 Bacteria 12232
80 Ga0500573_0000014 3300053140 Bacteria 193353
81 Ga0500616_0000027 3300053153 Bacteria 441053
82 Ga0500616_0000060 3300053153 Bacteria 252252
83 Ga0500616_0151713 3300053153 Bacteria 1072
84 Ga0500645_017723 3300053730 Bacteria 2228
85 2862993522 2862993130 Bacteria 3860849
86 2587863754 2585428094 Bacteria 3604039
87 2643768526 2643221549 Bacteria 4042819
88 2643848806 2643221566 Bacteria 3460379
89 2643888322 2643221575 Bacteria 4022601
90 2643994966 2643221597 Bacteria 3347721
91 2644099706 2643221617 Bacteria 5139111
92 2644116592 2643221620 Bacteria 5134593
93 2644197937 2643221635 Bacteria 2632343
94 2644444801 2643221679 Bacteria 3839507
95 2723641254 2721755702 Bacteria 4373124
96 2731909040 2731639228 Bacteria 4187555
97 2734970154 2734482000 Bacteria 5525167
98 2738870373 2738541305 Bacteria 4910150
99 2774383509 2773857759 Bacteria 2963774
100 2808628617 2808606306 Bacteria 3608896
101 2808884870 2808606368 Bacteria 3174172
102 2808901136 2808606372 Bacteria 4649509
103 2809226688 2808606447 Bacteria 3572005
104 2812331484 2811994874 Bacteria 5367947
105 2821269205 2821268502 Bacteria 3750023
106 2835189385 2835188231 Bacteria 3476928
107 2844854402 2844852863 Bacteria 3849151
108 2852632898 2852632344 Bacteria 3463163
109 2857722302 2857720070 Bacteria 3189373
110 2857739098 2857737099 Bacteria 3104305
111 2870629576 2870628048 Bacteria 3696012
112 2919445651 2919443155 Bacteria 4072969
113 2928091055 2928090899 Bacteria 3158267
114 2932433931 2932431166 Bacteria 4215299
115 2935410666 2935409751 Bacteria 4179611
116 2977251988 2977251589 Bacteria 2952848
117 2984582195 2984580707 Bacteria 3351387
118 8004213450 8004212874 Bacteria 2861420
119 8046353703 8046352972 Bacteria 3613806
120 8056039302 8056037122 Bacteria 3854319
121 8057347487 8057345674 Bacteria 4160394
122 rootL2_10196087
123 Ga0068869_100164498
124 Ga0070671_100036400
125 Ga0070710_10034814
126 Ga0070707_100156772
127 Ga0070672_100506130
128 Ga0068861_100252109
129 Ga0075365_10005630
130 Ga0075365_10020633
131 Ga0075368_10038326
132 Ga0075363_100042579
133 Ga0075363_100220403
134 Ga0075364_10004828
135 Ga0075364_10016016
136 Ga0075367_10035729
137 Ga0075369_10010580
138 Ga0111539_10113977
139 Ga0207692_10200239
140 Ga0207688_10049175
141 Ga0207646_10150740
142 Ga0207675_100025498
143 Ga0209813_10036366
144 Ga0265340_10000166
145 Ga0307413_10049911
146 Ga0307406_10000236
147 Ga0307406_10023600
148 Ga0307409_100642054
149 Ga0307416_100449236
150 Ga0395900_0213867
151 Ga0439465_0047603
152 Ga0451791_1207242
153 Ga0466972_0031060
154 Ga0466965_0021069
155 Ga0466970_0005646
156 Ga0466960_0203391
157 Ga0466967_0061710
158 Ga0495638_0032429
159 Ga0495654_0060016
160 Ga0496108_0325704
161 Ga0496114_0092118
162 Ga0496114_0149238
163 Ga0496117_0000387
164 Ga0496119_0003920
165 Ga0496120_0005149
166 Ga0496121_0197414
167 Ga0496122_0004879
168 Ga0496125_0001233
169 Ga0496126_0053444
170 Ga0496126_0058633
171 Ga0501032_0312659
172 Ga0501034_0066113
173 Ga0501037_0102077
174 Ga0501040_0417962
175 Ga0501043_0008520
176 Ga0501047_0016971
177 Ga0501069_0016917
178 Ga0501070_0001420
179 Ga0501070_0024911
180 Ga0501070_0469599
181 Ga0501071_0001998
182 Ga0501072_0389501
183 Ga0501073_0009038
184 Ga0501076_0320935
185 Ga0501080_0000023
186 nmdc:mga00v17_11866_c1
187 nmdc:mga00v17_69618_c1
188 nmdc:mga00v17_7206_c1
189 nmdc:mga0yw44_10081_c1
190 nmdc:mga0yw44_63304_c1
191 nmdc:mga06z11_3092_c1
192 nmdc:mga06r32_325530_c1
193 nmdc:mga08y16_130267_c1
194 nmdc:mga0sz30_29272_c1
195 Ga0500556_0001518
196 Ga0500593_038995
197 Ga0500655_010342
198 Ga0500559_0000847
199 Ga0500559_0003455
200 Ga0500568_0002050
201 Ga0500573_0000014
202 Ga0500616_0000027
203 Ga0500616_0000060
204 Ga0500616_0151713
205 Ga0500645_017723
206 2862993522
207 2587863754
208 2643768526
209 2643848806
210 2643888322
211 2643994966
212 2644099706
213 2644116592
214 2644197937
215 2644444801
216 2723641254
217 2731909040
218 2734970154
219 2738870373
220 2774383509
221 2808628617
222 2808884870
223 2808901136
224 2809226688
225 2812331484
226 2821269205
227 2835189385
228 2844854402
229 2852632898
230 2857722302
231 2857739098
232 2870629576
233 2919445651
234 2928091055
235 2932433931
236 2935410666
237 2977251988
238 2984582195
239 8004213450
240 8046353703
241 8056039302
242 8057347487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

124

333

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.915 33 321
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8978 33 321
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8964 33 321
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8933 33 320
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8765 33 321
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9289 81 322 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9195 33 320 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.914 81 322 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9117 81 325 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9085 82 324 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1Q3T0E7-F1-model_v4 Sugar ABC transporter permease 0.9755 42 328 GO:0005886
GO:0055085
AF-A0A6B1UJ66-F1-model_v4 deleted 0.967 43 329
AF-A0A4T0V3Z9-F1-model_v4 Sugar ABC transporter permease 0.9667 46 328 GO:0005886
GO:0055085
AF-A0A1Q3T0E7-F1-model_v4 Sugar ABC transporter permease 0.9623 42 328 GO:0005886
GO:0055085
AF-A0A1U9R086-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.962 40 328 GO:0005886
GO:0055085

Map